Germany
Japan
United Kingdom
China
Peroxidase Conjugated Affinity Purified Goat anti-Mouse IgG [H&L]
| Applications | WB: 1: 1,000; ICC: 1:200; IP: 1:200 |
| Reactivities | Mouse IgG |
| Conjugation | HRP |
| Immunogen | Mouse IgG, whole molecule |
Antibodies
DownloadUSD 428.00
In Stock
USD 180.00
In Stock
DDK Rabbit monoclonal antibody,clone OTIR5G2, recognizes both N-terminal and C-terminal DDK tags
| Applications | ELISA, IP, WB |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Pdpn hamster monoclonal antibody, clone 811, Purified
| Applications | IHC, IP, WB |
| Reactivities | Mouse |
PGK1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Thermolysin rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bacillus sp. |
| Immunogen | Thermolysin isolated and purified from Bacillus thermoproteolyticus rokko. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-HNRPA0 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
Rabbit Polyclonal H3K27me3S28p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
| Applications | Dot, ELISA, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
TDH1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | Glyceraldehyde-3-Phosphate Dehydrogenase isolated and purified from Baker's Yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-HNRPL Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
Monkey IgG (Fc specific) goat polyclonal antibody, FITC
| Applications | Can be used: • In direct staining of cytoplasmic IgG in fixed Monkey cells and tissue substrates. • To identify circulating IgG antibodies in serodiagnostic microbiology and autoimmune diseases. • To identify a specific antigen or immune complex using a reference antibody of Monkey in the middle layer of the test procedure. This immunoconjugate is not pre-diluted. The optimum working dilution of each conjugate should be established by titration before being used. Excess labelled antibody must be avoided because it may cause high unspecific background staining and interfere with the specific signal. Recommended Working Dilution: 1/20-1/80. |
| Reactivities | Monkey |
| Conjugation | FITC |
| Immunogen | Purified normal IgG isolated from pooled Rhesus Monkey serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-Histone H4K20me2 Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4 |
Rabbit Polyclonal Anti-EIF3G Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF3G antibody: synthetic peptide directed towards the middle region of human EIF3G. Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR |
OVAL rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Chicken |
| Immunogen | Ovalbumin from Hen Egg White (native protein) |
Anti-GST rabbit polyclonal antibody
| Applications | IP, WB |
| Immunogen | Rabbits were immunized with recombinant Glutathione-S-transferase (GST) from E.coli . After multiple immunizations in Freund's adjuvant serum was collected. Antibodies were immunoaffinity purified using GST immobilized on a solid support. |
Rabbit Polyclonal Anti-ARF1 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA |
Herpes Virus Type 8 / HHV8 Cyclin sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Human |
| Immunogen | Inclusion Bodies from E. Coli expressing His-tagged full length Human Cyclin G2 protein. |
PGI1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | Phosphoglucose isomerase isolated and purified from baker’s yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Asialoganglioside GM1 rabbit polyclonal antibody, Ig Fraction
| Applications | Assay, CT, FC, FN, IHC, IP |
| Reactivities | Mouse, Rat |
| Immunogen | Asialo GM1 purified from Bovine brain tissue, methylated BSA and complete Freund's adjuvant. |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit anti-DBI Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBI |
Active filters
Applications
- IP
Isotypes
- IgG
Filter by
Target Symbol
- H3-4 (18)
- C3 (14)
- ALB (10)
- DDK (10)
- TP53 (10)
- EGFR (9)
- MDH1 (9)
- HIST1H3A (8)
- LDHA (8)
- LTF (8)
- AKT1 (6)
- CA1 (6)
- CREB1 (6)
- CTNNB1 (6)
- HISTONE H3 (6)
- LDHB (6)
- S PROTEIN (6)
- SQSTM1 (6)
- BAX (5)
- CD3E (5)
- CDK1 (5)
- EIF4E (5)
- EIF4EBP1 (5)
- GSK3B (5)
- H3C1 (5)
- JUN (5)
- MAPK1 (5)
- STAT1 (5)
- STAT3 (5)
- ACTA1 (4)
- CASP3 (4)
- CAT (4)
- CDK2 (4)
- CDKN1A (4)
- CYCS (4)
- GLUD1 (4)
- MAPK8 (4)
- MAPT (4)
- MCM5 (4)
- MCM7 (4)
- NF2 (4)
- NFKBIA (4)
- PDHA1 (4)
- RELA (4)
- SMAD2 (4)
- VCAM1 (4)
- YAP1 (4)
- ACLY (3)
- ALDOA (3)
- ATF2 (3)
- BAK1 (3)
- BCHE (3)
- BCL2 (3)
- BCL2L1 (3)
- CBX3 (3)
- CCND1 (3)
- CDC37 (3)
- CDK4 (3)
- CDKN2A (3)
- CES1 (3)
- CHEK2 (3)
- COL5A1 (3)
- COL6A1 (3)
- CP (3)
- CPA1 (3)
- CS (3)
- CTCF (3)
- CTNNA1 (3)
- CTSC (3)
- DDB1 (3)
- DDK (FLAG) (3)
- DNMT1 (3)
- ENO1 (3)
- ENO3 (3)
- EPHB1 (3)
- EZH2 (3)
- FADD (3)
- FBL (3)
- FLOT1 (3)
- FUBP1 (3)
- FUCA1 (3)
- GAPDH (3)
- GRIA2 (3)
- GYS1 (3)
- H2AX (3)
- H2BC12 (3)
- H2BC3 (3)
- HADH (3)
- HADHA (3)
- HIST3H3 (3)
- HMOX1 (3)
- HSPB1 (3)
- IGF2BP3 (3)
- ILF3 (3)
- ISL1 (3)
- LMNB1 (3)
- MAP2K1 (3)
- MAPK3 (3)
- PGA5 (3)
- PGAM2 (3)
Reactivities
- Human (1252)
- Mouse (963)
- Rat (860)
- Other (Wide Range) (22)
- Hamster (17)
- Bovine (15)
- Monkey (15)
- C-term DDK (10)
- Chicken (8)
- Pig (7)
- SARS-CoV-2 (7)
- Zebrafish (6)
- Rhesus Monkey (5)
- X. tropicalis (4)
- Xenopus (4)
- Dog (3)
- Sheep (3)
- Broad (2)
- Fusion proteins containing the Flag Tag (2)
- N-term and C-term DDK (2)
- Cow (1)
- Drosophila melanogaster (1)
- Feline (1)
- Fish (1)
- Goat (1)
- Rabbit (1)
- Saccharomyces cerevisiae (1)
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
- Unmodified (347)
- Phospho S15 (2)
- Phospho S727 (2)
- Phospho S9 (2)
- Phospho-specific (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K27 (1)
- Acetyl K5 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- MonoMethyl K36 (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S157 (1)
- Phospho S2 (1)
- Phospho S21 (1)
- Phospho S22 (1)
- Phospho S240/244 (1)
- Phospho S259 (1)
- Phospho S298 (1)
- Phospho S33 (1)
- Phospho S380 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S473 (1)
- Phospho S51 (1)
- Phospho S621 (1)
- Phospho S65 (1)
- Phospho S82 (1)
- Phospho S957 (1)
- Phospho T183/T172 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T359 (1)
- Phospho T669 (1)
- Phospho Y1068 (1)
- Phospho Y15 (1)
- Phospho Y416/Y416 (1)
- TriMethyl K56 (1)
- pan-Mono-Methyl K (1)
- pan-tri-Methyl K (1)
Assay Types
Families
- Druggable Genome (172)
- Transcription Factors (48)
- Transmembrane (28)
- Secreted Protein (22)
- Stem cell - Pluripotency (21)
- Protease (18)
- Protein Kinase (14)
- ES Cell Differentiation/IPS (10)
- Phosphatase (8)
- Nuclear Hormone Receptor (5)
- Adult stem cells (1)
- GPCR (1)
- Ion Channels: Calcium (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
Pathways
- Systemic lupus erythematosus (37)
- Metabolic pathways (28)
- Pathways in cancer (22)
- Focal adhesion (17)
- Cell cycle (13)
- Glycolysis / Gluconeogenesis (10)
- Huntington's disease (10)
- Pyruvate metabolism (10)
- ECM-receptor interaction (9)
- MAPK signaling pathway (9)
- Citrate cycle (TCA cycle) (8)
- Insulin signaling pathway (8)
- Complement and coagulation cascades (7)
- DNA replication (7)
- Oocyte meiosis (7)
- Prostate cancer (7)
- Small cell lung cancer (7)
- Adipocytokine signaling pathway (6)
- Apoptosis (6)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (6)
- Axon guidance (6)
- Colorectal cancer (6)
- Endocytosis (6)
- Gap junction (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Regulation of actin cytoskeleton (6)
- Toll-like receptor signaling pathway (6)
- Chronic myeloid leukemia (5)
- Leukocyte transendothelial migration (5)
- Neuroactive ligand-receptor interaction (5)
- Nucleotide excision repair (5)
- Pathogenic Escherichia coli infection (5)
- Proteasome (5)
- Purine metabolism (5)
- Pyrimidine metabolism (5)
- RIG-I-like receptor signaling pathway (5)
- RNA degradation (5)
- Spliceosome (5)
- Tight junction (5)
- Chemokine signaling pathway (4)
- Porphyrin and chlorophyll metabolism (4)
- Prion diseases (4)
- T cell receptor signaling pathway (4)
- Ubiquitin mediated proteolysis (4)
- Vascular smooth muscle contraction (4)
- Wnt signaling pathway (4)
- mTOR signaling pathway (4)
- Acute myeloid leukemia (3)
- Adherens junction (3)
- Amyotrophic lateral sclerosis (ALS) (3)
- B cell receptor signaling pathway (3)
- Calcium signaling pathway (3)
- Cell adhesion molecules (CAMs) (3)
- Cytokine-cytokine receptor interaction (3)
- Dilated cardiomyopathy (3)
- Endometrial cancer (3)
- Hematopoietic cell lineage (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Melanogenesis (3)
- Natural killer cell mediated cytotoxicity (3)
- Neurotrophin signaling pathway (3)
- Nitrogen metabolism (3)
- Non-homologous end-joining (3)
- Notch signaling pathway (3)
- PPAR signaling pathway (3)
- Primary immunodeficiency (3)
- Propanoate metabolism (3)
- RNA polymerase (3)
- Thyroid cancer (3)
- Type II diabetes mellitus (3)
- p53 signaling pathway (3)
- Alzheimer's disease (2)
- Basal cell carcinoma (2)
- Butanoate metabolism (2)
- Cysteine and methionine metabolism (2)
- Cytosolic DNA-sensing pathway (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- ErbB signaling pathway (2)
- Fatty acid metabolism (2)
- Glioma (2)
- Glycine (2)
- Histidine metabolism (2)
- Homologous recombination (2)
- Long-term depression (2)
- Long-term potentiation (2)
- Lysine degradation (2)
- Mismatch repair (2)
- NOD-like receptor signaling pathway (2)
- Pancreatic cancer (2)
- Progesterone-mediated oocyte maturation (2)
- Renal cell carcinoma (2)
- Riboflavin metabolism (2)
- Selenoamino acid metabolism (2)
- TGF-beta signaling pathway (2)
- Taste transduction (2)
- Valine (2)
- Vibrio cholerae infection (2)
- serine and threonine metabolism (2)
- Allograft rejection (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Androgen and estrogen metabolism (1)
- Antigen processing and presentation (1)
- Arachidonic acid metabolism (1)
- Asthma (1)
- Autoimmune thyroid disease (1)
- Biosynthesis of unsaturated fatty acids (1)
- Cyanoamino acid metabolism (1)
- Fatty acid biosynthesis (1)
- Fatty acid elongation in mitochondria (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Folate biosynthesis (1)
- Fructose and mannose metabolism (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- GnRH signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Limonene and pinene degradation (1)
- Lysosome (1)
- Melanoma (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Methane metabolism (1)
- Non-small cell lung cancer (1)
- One carbon pool by folate (1)
- Parkinson's disease (1)
- Regulation of autophagy (1)
- Starch and sucrose metabolism (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- Viral myocarditis (1)
- beta-Alanine metabolism (1)
- leucine and isoleucine biosynthesis (1)
- leucine and isoleucine degradation (1)