Germany
Japan
United Kingdom
China
Antibodies
Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
USD 428.00
In Stock
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit monoclonal anti-ST13 Antibody, clone OTIR191G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Mouse
Applications
- WB
Isotypes
- IgG
Families
- Druggable Genome
Filter by
Target Symbol
- AKT1 (42)
- EGFR (31)
- MAPT (25)
- RELA (25)
- JUN (21)
- CREB1 (18)
- CTNNB1 (18)
- EZR (18)
- IRS1 (18)
- SMAD1 (18)
- CDC25A (17)
- STAT3 (17)
- ATF2 (16)
- ESR1 (16)
- NR3C1 (16)
- RPS6KB1 (16)
- SMAD3 (16)
- STAT1 (16)
- TP53 (16)
- KDR (15)
- MAPK14 (15)
- NFKBIA (15)
- APP (14)
- ERBB2 (14)
- FOXO1 (14)
- HDAC2 (14)
- LCK (14)
- PRKCD (14)
- PTPN11 (14)
- RAF1 (14)
- SMAD2 (14)
- HDAC1 (13)
- PTEN (13)
- BRAF (12)
- CCNB1 (12)
- DOK1 (12)
- GSK3B (12)
- HDAC5 (12)
- IGF1R (12)
- MAPK1 (12)
- MET (12)
- PAK1 (12)
- SRC (12)
- BAD (11)
- BCL2 (11)
- CASP3 (11)
- CHEK2 (11)
- CHUK (11)
- CSF1R (11)
- JAK2 (11)
- MAP3K7 (11)
- MAPK8 (11)
- NOS3 (11)
- PRKCA (11)
- PTK2 (11)
- PXN (11)
- RB1 (11)
- SNCA (11)
- STAT5A (11)
- VASP (11)
- ABL1 (10)
- BAX (10)
- BCL2L1 (10)
- CDK2 (10)
- CTTN (10)
- GJA1 (10)
- GRIN2B (10)
- HSP90AB1 (10)
- MAP2K1 (10)
- RAB5A (10)
- ROCK2 (10)
- RUNX1 (10)
- SYK (10)
- UCHL1 (10)
- VCL (10)
- CASP9 (9)
- DNM1 (9)
- FGFR1 (9)
- GAB2 (9)
- GSK3A (9)
- ITGB3 (9)
- KDM1A (9)
- MAP2K4 (9)
- MAPK3 (9)
- NGFR (9)
- PDCD4 (9)
- PLCG1 (9)
- PRKAA1 (9)
- RAN (9)
- SHC1 (9)
- STAT5B (9)
- TH (9)
- AIFM1 (8)
- BCAR1 (8)
- CASP6 (8)
- CASP7 (8)
- CDK1 (8)
- CDK5 (8)
- CDKN1B (8)
- DES (8)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Pathways in cancer (1243)
- MAPK signaling pathway (762)
- Focal adhesion (692)
- Metabolic pathways (621)
- Neurotrophin signaling pathway (590)
- Prostate cancer (540)
- Chemokine signaling pathway (529)
- ErbB signaling pathway (492)
- Regulation of actin cytoskeleton (475)
- Chronic myeloid leukemia (471)
- Colorectal cancer (470)
- Pancreatic cancer (461)
- T cell receptor signaling pathway (453)
- Insulin signaling pathway (426)
- Cell cycle (416)
- Cytokine-cytokine receptor interaction (386)
- Wnt signaling pathway (378)
- Toll-like receptor signaling pathway (371)
- Small cell lung cancer (367)
- Apoptosis (353)
- Neuroactive ligand-receptor interaction (350)
- Glioma (344)
- Acute myeloid leukemia (343)
- B cell receptor signaling pathway (341)
- Melanoma (337)
- Jak-STAT signaling pathway (333)
- Endometrial cancer (331)
- Adherens junction (328)
- Leukocyte transendothelial migration (328)
- Progesterone-mediated oocyte maturation (326)
- Fc gamma R-mediated phagocytosis (324)
- Non-small cell lung cancer (324)
- Adipocytokine signaling pathway (319)
- Natural killer cell mediated cytotoxicity (312)
- VEGF signaling pathway (311)
- Renal cell carcinoma (304)
- Calcium signaling pathway (302)
- GnRH signaling pathway (296)
- Fc epsilon RI signaling pathway (292)
- Endocytosis (289)
- Alzheimer's disease (287)
- Epithelial cell signaling in Helicobacter pylori infection (284)
- Axon guidance (278)
- Gap junction (258)
- Tight junction (258)
- Melanogenesis (249)
- TGF-beta signaling pathway (247)
- Bladder cancer (242)
- Oocyte meiosis (242)
- p53 signaling pathway (228)
- Huntington's disease (224)
- Vascular smooth muscle contraction (219)
- Amyotrophic lateral sclerosis (ALS) (218)
- NOD-like receptor signaling pathway (210)
- Long-term potentiation (204)
- Long-term depression (189)
- mTOR signaling pathway (186)
- RIG-I-like receptor signaling pathway (171)
- Pathogenic Escherichia coli infection (167)
- Type II diabetes mellitus (155)
- Ubiquitin mediated proteolysis (147)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (142)
- Thyroid cancer (136)
- Hypertrophic cardiomyopathy (HCM) (134)
- Dilated cardiomyopathy (128)
- Hematopoietic cell lineage (119)
- Basal cell carcinoma (111)
- Cell adhesion molecules (CAMs) (111)
- Parkinson's disease (107)
- Prion diseases (99)
- Viral myocarditis (95)
- Cytosolic DNA-sensing pathway (94)
- Glycolysis / Gluconeogenesis (92)
- Phosphatidylinositol signaling system (92)
- Dorso-ventral axis formation (90)
- Primary immunodeficiency (88)
- ECM-receptor interaction (86)
- Notch signaling pathway (85)
- Vibrio cholerae infection (82)
- Purine metabolism (80)
- Hedgehog signaling pathway (72)
- PPAR signaling pathway (71)
- Nucleotide excision repair (69)
- Antigen processing and presentation (68)
- Base excision repair (65)
- Arginine and proline metabolism (62)
- Complement and coagulation cascades (59)
- Inositol phosphate metabolism (59)
- Lysosome (55)
- Fructose and mannose metabolism (54)
- ABC transporters (50)
- Tyrosine metabolism (50)
- Pyruvate metabolism (49)
- Metabolism of xenobiotics by cytochrome P450 (47)
- Drug metabolism - cytochrome P450 (45)
- Systemic lupus erythematosus (44)
- Retinol metabolism (43)
- Valine (43)
- Type I diabetes mellitus (42)
- Homologous recombination (41)
- Pyrimidine metabolism (41)
- Regulation of autophagy (40)
- Tryptophan metabolism (40)
- Proteasome (39)
- Butanoate metabolism (38)
- DNA replication (38)
- Glycerolipid metabolism (38)
- Maturity onset diabetes of the young (37)
- Cardiac muscle contraction (36)
- leucine and isoleucine degradation (36)
- Alanine (35)
- Olfactory transduction (35)
- aspartate and glutamate metabolism (35)
- Glutathione metabolism (34)
- Mismatch repair (34)
- Renin-angiotensin system (33)
- Fatty acid metabolism (32)
- Galactose metabolism (32)
- Citrate cycle (TCA cycle) (30)
- Arachidonic acid metabolism (28)
- Pentose phosphate pathway (28)
- Cysteine and methionine metabolism (27)
- Non-homologous end-joining (27)
- Propanoate metabolism (27)
- SNARE interactions in vesicular transport (27)
- Histidine metabolism (26)
- Oxidative phosphorylation (26)
- Taste transduction (26)
- beta-Alanine metabolism (26)
- Drug metabolism - other enzymes (24)
- Nitrogen metabolism (24)
- Lysine degradation (23)
- Amino sugar and nucleotide sugar metabolism (22)
- Allograft rejection (21)
- Autoimmune thyroid disease (21)
- Phenylalanine metabolism (21)
- Androgen and estrogen metabolism (20)
- Glycerophospholipid metabolism (20)
- Glycine (20)
- Sphingolipid metabolism (20)
- Starch and sucrose metabolism (20)
- serine and threonine metabolism (20)
- Porphyrin and chlorophyll metabolism (18)
- Basal transcription factors (17)
- Graft-versus-host disease (17)
- Taurine and hypotaurine metabolism (14)
- Pentose and glucuronate interconversions (13)
- Folate biosynthesis (12)
- Primary bile acid biosynthesis (12)
- RNA degradation (12)
- Circadian rhythm - mammal (11)
- Glycosaminoglycan degradation (11)
- Linoleic acid metabolism (11)
- Methane metabolism (11)
- Ribosome (11)
- Ascorbate and aldarate metabolism (10)
- Asthma (10)
- Ether lipid metabolism (10)
- Nicotinate and nicotinamide metabolism (10)
- Spliceosome (10)
- leucine and isoleucine biosynthesis (10)
- Glyoxylate and dicarboxylate metabolism (9)
- Limonene and pinene degradation (9)
- N-Glycan biosynthesis (8)
- Riboflavin metabolism (8)
- Selenoamino acid metabolism (8)
- Fatty acid biosynthesis (7)
- One carbon pool by folate (7)
- Other glycan degradation (7)
- Terpenoid backbone biosynthesis (6)
- Biosynthesis of unsaturated fatty acids (5)
- C21-Steroid hormone metabolism (5)
- Pantothenate and CoA biosynthesis (5)
- Steroid biosynthesis (5)
- Aminoacyl-tRNA biosynthesis (4)
- O-Glycan biosynthesis (4)
- Synthesis and degradation of ketone bodies (4)
- Vitamin B6 metabolism (4)
- Fatty acid elongation in mitochondria (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Heparan sulfate biosynthesis (3)
- RNA polymerase (3)
- alpha-Linolenic acid metabolism (3)
- Caffeine metabolism (2)
- Glycosphingolipid biosynthesis - globo series (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Phenylalanine (2)
- Thiamine metabolism (2)
- tyrosine and tryptophan biosynthesis (2)
- Chondroitin sulfate biosynthesis (1)
- D-Arginine and D-ornithine metabolism (1)
- Keratan sulfate biosynthesis (1)
- Sulfur metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)