Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
USD 380.00
2 Weeks
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
IL12A mouse monoclonal antibody, Azide Free
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Rabbit polyclonal JAK2 (Tyr570) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JAK2 around the phosphorylation site of tyrosine 750 (G-D-YP-G-Q). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780 |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730 |
| Modifications | Phospho-specific |
IFNAR2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR2 |
CBLB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CBLB |
Rabbit Polyclonal Anti-CSH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Active filters
Applications
- WB
Pathways
- Jak-STAT signaling pathway
Filter by
Target Symbol
- AKT1 (116)
- STAT5A (69)
- STAT4 (65)
- PIK3CG (63)
- SOCS3 (59)
- CSF3 (57)
- STAT1 (51)
- MYC (50)
- CSF2 (49)
- IL20 (46)
- PIK3R5 (46)
- CCND2 (41)
- AKT2 (39)
- CSH1 (39)
- CCND1 (35)
- PTPN11 (35)
- PRL (33)
- STAT3 (33)
- IL6 (31)
- CSF2RB (30)
- IL10RA (29)
- PIK3CD (29)
- IL2RB (28)
- IFNLR1 (27)
- IL24 (27)
- IFNG (26)
- BCL2L1 (25)
- CSF2RA (25)
- JAK2 (25)
- IL3RA (24)
- IL20RA (22)
- IL2 (21)
- IL12A (20)
- IL15RA (19)
- PIAS2 (19)
- AKT3 (17)
- EPOR (17)
- CBLC (16)
- IL15 (14)
- IL3 (14)
- JAK3 (14)
- SOCS1 (14)
- STAT5B (14)
- IL12B (13)
- IL23R (13)
- IL4 (13)
- STAT6 (13)
- EP300 (12)
- IFNL1 (11)
- IL10 (11)
- IL7 (11)
- PIK3R1 (11)
- PTPN6 (11)
- EPO (10)
- GH2 (10)
- GRB2 (10)
- IL6R (10)
- IL9 (9)
- PIAS1 (9)
- STAT2 (9)
- CRLF2 (8)
- IFNB1 (8)
- IL19 (8)
- IL2RA (8)
- SOCS4 (8)
- TSLP (8)
- TYK2 (8)
- CBL (7)
- CCND3 (7)
- IFNA2 (7)
- IL12RB1 (7)
- IL13 (7)
- IL22 (7)
- IL6ST (7)
- CNTF (6)
- CREBBP (6)
- IFNA6 (6)
- IFNGR2 (6)
- IL11RA (6)
- IL21 (6)
- JAK1 (6)
- OSM (6)
- PIAS3 (6)
- PIM1 (6)
- IFNAR1 (5)
- IFNL2 (5)
- IFNL3 (5)
- IL13RA1 (5)
- IL23A (5)
- IL4R (5)
- LEP (5)
- PRLR (5)
- CLCF1 (4)
- CTF1 (4)
- IFNGR1 (4)
- IL22RA1 (4)
- IL5 (4)
- LIF (4)
- PIAS4 (4)
- PIK3CA (4)
Reactivities
- Human (1776)
- Mouse (923)
- Rat (842)
- Dog (99)
- Monkey (95)
- Bovine (15)
- Pig (13)
- Chicken (7)
- Cow (7)
- Xenopus (5)
- Canine (4)
- Chimpanzee (4)
- Rhesus Monkey (4)
- Feline (3)
- Hamster (3)
- Sheep (3)
- Primate (2)
- Drosophila (1)
- Guinea Pig (1)
- Horse (1)
- Macaque (1)
- Porcine (1)
- Rabbit (1)
- X. tropicalis (1)
- Yeast (1)
- Zebrafish (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1927)
- Secreted Protein (625)
- ES Cell Differentiation/IPS (535)
- Transmembrane (418)
- Transcription Factors (363)
- Protein Kinase (231)
- Stem cell relevant signaling - JAK/STAT signaling pathway (220)
- Stem cell - Pluripotency (129)
- Stem cell relevant signaling - DSL/Notch pathway (123)
- Stem cell relevant signaling - Wnt Signaling pathway (85)
- Embryonic stem cells (50)
- Induced pluripotent stem cells (50)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (50)
- Phosphatase (46)
- Adult stem cells (4)