Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Active filters
Category
- Antibodies
Reactivities
- Rat
Clonalities
- Polyclonal
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- AKT1 (47)
- EGFR (29)
- JUN (21)
- CTNNB1 (19)
- SMAD3 (18)
- GAPDH (17)
- SMAD1 (17)
- ACTB (16)
- SMAD2 (16)
- CASP3 (13)
- SRC (13)
- KDR (12)
- STAT5B (12)
- BCL2L1 (11)
- MAPK8 (11)
- PDGFRB (11)
- MAPK3 (10)
- PRKCA (10)
- RUNX1 (10)
- STAT5A (10)
- AKT2 (9)
- BCL2 (8)
- CDH1 (8)
- CEBPA (8)
- GATA1 (8)
- GCG (8)
- HNF1B (8)
- HNF4A (8)
- MAP2 (8)
- SP1 (8)
- VIM (8)
- GATA4 (7)
- TNNI3 (7)
- BDNF (6)
- CDX2 (6)
- GFAP (6)
- HCRTR1 (6)
- HNF1A (6)
- PDGFRA (6)
- SOX2 (6)
- STAT6 (6)
- AKT3 (5)
- ALDH1A1 (5)
- CDH2 (5)
- CXCR4 (5)
- FGF4 (5)
- IGF1 (5)
- ITGB1 (5)
- KIT (5)
- NOTCH1 (5)
- SLC2A1 (5)
- SOX9 (5)
- TGFB1 (5)
- YBX1 (5)
- ACE (4)
- ACTN1 (4)
- ANGPT1 (4)
- AXIN1 (4)
- BSG (4)
- CD69 (4)
- CD70 (4)
- CEBPB (4)
- CSNK1A1 (4)
- CSNK2A1 (4)
- CXCL12 (4)
- FN1 (4)
- FOXA2 (4)
- ITGB3 (4)
- JMJD6 (4)
- KLF4 (4)
- MAPK6 (4)
- NECTIN1 (4)
- NEUROD1 (4)
- NT5E (4)
- PTPRC (4)
- SERPINA1 (4)
- SMAD5 (4)
- TCF3 (4)
- ABCB1 (3)
- ABCG2 (3)
- ACVR1 (3)
- AXIN2 (3)
- BMP2 (3)
- BMP6 (3)
- CCR5 (3)
- CD44 (3)
- CYP3A4 (3)
- DKK2 (3)
- EGF (3)
- EPO (3)
- FSHR (3)
- GATA6 (3)
- HGF (3)
- ID2 (3)
- ID4 (3)
- INS (3)
- ITGA4 (3)
- ITGAM (3)
- JAG1 (3)
- LAMA1 (3)
Applications
Antibody Hosts
Conjugates
Modifications
Pathways
- Pathways in cancer (379)
- Focal adhesion (270)
- Colorectal cancer (244)
- MAPK signaling pathway (199)
- ErbB signaling pathway (183)
- Pancreatic cancer (166)
- Prostate cancer (161)
- Melanoma (147)
- Adherens junction (145)
- Endometrial cancer (141)
- Chronic myeloid leukemia (137)
- Wnt signaling pathway (136)
- Glioma (135)
- Acute myeloid leukemia (127)
- Tight junction (127)
- Neurotrophin signaling pathway (119)
- Cytokine-cytokine receptor interaction (118)
- Jak-STAT signaling pathway (118)
- Regulation of actin cytoskeleton (117)
- Non-small cell lung cancer (113)
- VEGF signaling pathway (106)
- Renal cell carcinoma (105)
- Toll-like receptor signaling pathway (105)
- T cell receptor signaling pathway (101)
- TGF-beta signaling pathway (101)
- GnRH signaling pathway (96)
- Apoptosis (95)
- Chemokine signaling pathway (95)
- Fc epsilon RI signaling pathway (94)
- Small cell lung cancer (94)
- B cell receptor signaling pathway (93)
- Progesterone-mediated oocyte maturation (92)
- Epithelial cell signaling in Helicobacter pylori infection (89)
- Insulin signaling pathway (88)
- Gap junction (87)
- Fc gamma R-mediated phagocytosis (86)
- Endocytosis (85)
- Adipocytokine signaling pathway (80)
- Leukocyte transendothelial migration (80)
- mTOR signaling pathway (79)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (63)
- Pathogenic Escherichia coli infection (61)
- Melanogenesis (60)
- Calcium signaling pathway (57)
- Cell adhesion molecules (CAMs) (55)
- Hypertrophic cardiomyopathy (HCM) (52)
- Basal cell carcinoma (50)
- Bladder cancer (50)
- Dilated cardiomyopathy (48)
- Hematopoietic cell lineage (45)
- Alzheimer's disease (44)
- Dorso-ventral axis formation (44)
- Natural killer cell mediated cytotoxicity (41)
- Thyroid cancer (41)
- Cell cycle (39)
- Metabolic pathways (39)
- Maturity onset diabetes of the young (38)
- Amyotrophic lateral sclerosis (ALS) (34)
- Viral myocarditis (33)
- ECM-receptor interaction (28)
- Type II diabetes mellitus (28)
- Hedgehog signaling pathway (27)
- Huntington's disease (27)
- Vibrio cholerae infection (26)
- Axon guidance (25)
- Long-term depression (25)
- NOD-like receptor signaling pathway (23)
- Long-term potentiation (20)
- Notch signaling pathway (20)
- Vascular smooth muscle contraction (20)
- p53 signaling pathway (20)
- Glycolysis / Gluconeogenesis (18)
- Oocyte meiosis (18)
- Prion diseases (17)
- RIG-I-like receptor signaling pathway (15)
- Parkinson's disease (13)
- Neuroactive ligand-receptor interaction (11)
- Phosphatidylinositol signaling system (10)
- Retinol metabolism (8)
- Cardiac muscle contraction (7)
- Primary immunodeficiency (7)
- Renin-angiotensin system (7)
- ABC transporters (6)
- Complement and coagulation cascades (6)
- Systemic lupus erythematosus (6)
- Type I diabetes mellitus (6)
- Autoimmune thyroid disease (5)
- Nicotinate and nicotinamide metabolism (5)
- Allograft rejection (4)
- Lysosome (4)
- Purine metabolism (4)
- Pyrimidine metabolism (4)
- Antigen processing and presentation (3)
- Drug metabolism - cytochrome P450 (3)
- Drug metabolism - other enzymes (3)
- Graft-versus-host disease (3)
- Linoleic acid metabolism (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Oxidative phosphorylation (3)
- Regulation of autophagy (3)
- Amino sugar and nucleotide sugar metabolism (2)
- Fructose and mannose metabolism (2)
- Glutathione metabolism (2)
- Starch and sucrose metabolism (2)
- Tyrosine metabolism (2)
- Asthma (1)
- Citrate cycle (TCA cycle) (1)
- Cysteine and methionine metabolism (1)
- PPAR signaling pathway (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Pyruvate metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- Ubiquitin mediated proteolysis (1)
- tyrosine and tryptophan biosynthesis (1)