Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
GFAP chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Recombinant Human GFAP (expressed in bacteria). After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks. |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, PE
| Applications | FC |
| Reactivities | Feline, Human, Rabbit |
| Conjugation | PE |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
USD 220.00
2 Weeks
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit Polyclonal Antibody against PROX1 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-214 amino acids from the Central region of human PROX1. |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
DLL4 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
PTCH1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1) |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Families
- ES Cell Differentiation/IPS
Citations
- Yes
Filter by
Category
Target Symbol
- GAPDH (15)
- CD4 (9)
- MKI67 (9)
- ACTB (7)
- CDH2 (7)
- PECAM1 (7)
- VIM (7)
- CTNNB1 (6)
- MAPK8 (6)
- CD34 (5)
- KDR (5)
- NCAM1 (5)
- CD44 (4)
- CD8A (4)
- CDH1 (4)
- CDX2 (4)
- CXCL12 (4)
- EPCAM (4)
- GATA4 (4)
- GFAP (4)
- ABCG2 (3)
- AKT1 (3)
- BCL2 (3)
- CD81 (3)
- KRT7 (3)
- MAPK3 (3)
- NOTCH1 (3)
- PTCH1 (3)
- TNNI3 (3)
- ACTN1 (2)
- AKT3 (2)
- BCL2L1 (2)
- BDNF (2)
- BSG (2)
- CASP3 (2)
- CDH5 (2)
- EGFR (2)
- ENG (2)
- FN1 (2)
- G6PC (2)
- ICAM1 (2)
- L1CAM (2)
- LAMP2 (2)
- PDX1 (2)
- PLAU (2)
- PRNP (2)
- SERPINA1 (2)
- SLC2A1 (2)
- SMURF2 (2)
- SOX9 (2)
- STAT5A (2)
- TGFB1 (2)
- ANPEP (1)
- BMP6 (1)
- BST2 (1)
- CDCP1 (1)
- CEBPA (1)
- CXCR4 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- DKK1 (1)
- DLL4 (1)
- FCGR3A (1)
- FGF21 (1)
- FSHR (1)
- GATA3 (1)
- GLI1 (1)
- GLI2 (1)
- GREM1 (1)
- HCRTR1 (1)
- HNF4A (1)
- IL10 (1)
- ITGA2B (1)
- ITGA4 (1)
- ITGA6 (1)
- ITGB3 (1)
- JMJD6 (1)
- LAMA1 (1)
- LAMP1 (1)
- LIF (1)
- MCAM (1)
- MYB (1)
- NANOG (1)
- NECTIN1 (1)
- NES (1)
- NEUROD1 (1)
- NKX2-1 (1)
- PDGFRA (1)
- PDGFRB (1)
- PRKCA (1)
- PROM1 (1)
- PROX1 (1)
- PTPRC (1)
- SLAMF1 (1)
- SMAD3 (1)
- SOX2 (1)
- TNFRSF8 (1)
- TUBB3 (1)
- WNT2 (1)
- WNT3A (1)
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (57)
- Cell adhesion molecules (CAMs) (53)
- Focal adhesion (49)
- Leukocyte transendothelial migration (33)
- Colorectal cancer (32)
- Hematopoietic cell lineage (27)
- Adherens junction (26)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (26)
- MAPK signaling pathway (26)
- Regulation of actin cytoskeleton (23)
- T cell receptor signaling pathway (23)
- Pancreatic cancer (21)
- Prostate cancer (21)
- Tight junction (21)
- Alzheimer's disease (20)
- Endometrial cancer (20)
- Metabolic pathways (20)
- Cytokine-cytokine receptor interaction (19)
- ErbB signaling pathway (19)
- Neurotrophin signaling pathway (19)
- Pathogenic Escherichia coli infection (19)
- Glycolysis / Gluconeogenesis (17)
- Melanoma (17)
- Wnt signaling pathway (17)
- Dilated cardiomyopathy (16)
- Hypertrophic cardiomyopathy (HCM) (16)
- Insulin signaling pathway (16)
- Adipocytokine signaling pathway (15)
- Antigen processing and presentation (15)
- Chronic myeloid leukemia (15)
- Fc epsilon RI signaling pathway (15)
- Small cell lung cancer (15)
- Primary immunodeficiency (14)
- Progesterone-mediated oocyte maturation (14)
- Toll-like receptor signaling pathway (14)
- VEGF signaling pathway (14)
- Basal cell carcinoma (13)
- Chemokine signaling pathway (13)
- Glioma (13)
- Prion diseases (13)
- Thyroid cancer (13)
- Viral myocarditis (13)
- Apoptosis (12)
- GnRH signaling pathway (12)
- Melanogenesis (12)
- Renal cell carcinoma (12)
- Acute myeloid leukemia (11)
- B cell receptor signaling pathway (11)
- ECM-receptor interaction (11)
- Endocytosis (11)
- Fc gamma R-mediated phagocytosis (11)
- Jak-STAT signaling pathway (11)
- Non-small cell lung cancer (11)
- Type II diabetes mellitus (11)
- Axon guidance (10)
- Epithelial cell signaling in Helicobacter pylori infection (10)
- Bladder cancer (9)
- Gap junction (9)
- NOD-like receptor signaling pathway (9)
- Natural killer cell mediated cytotoxicity (9)
- TGF-beta signaling pathway (9)
- Dorso-ventral axis formation (8)
- Hedgehog signaling pathway (8)
- Vibrio cholerae infection (8)
- mTOR signaling pathway (8)
- Amyotrophic lateral sclerosis (ALS) (7)
- RIG-I-like receptor signaling pathway (6)
- Calcium signaling pathway (5)
- Complement and coagulation cascades (4)
- Huntington's disease (4)
- Long-term depression (4)
- Long-term potentiation (4)
- Maturity onset diabetes of the young (4)
- Notch signaling pathway (4)
- Systemic lupus erythematosus (4)
- Vascular smooth muscle contraction (4)
- ABC transporters (3)
- Allograft rejection (3)
- Autoimmune thyroid disease (3)
- Cardiac muscle contraction (3)
- Cell cycle (3)
- Lysosome (3)
- Oocyte meiosis (3)
- Galactose metabolism (2)
- Graft-versus-host disease (2)
- Neuroactive ligand-receptor interaction (2)
- Parkinson's disease (2)
- Starch and sucrose metabolism (2)
- Type I diabetes mellitus (2)
- Ubiquitin mediated proteolysis (2)
- p53 signaling pathway (2)
- Asthma (1)
- Drug metabolism - cytochrome P450 (1)
- Drug metabolism - other enzymes (1)
- Glutathione metabolism (1)
- Linoleic acid metabolism (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- PPAR signaling pathway (1)
- Phosphatidylinositol signaling system (1)
- Primary bile acid biosynthesis (1)
- Renin-angiotensin system (1)
- Retinol metabolism (1)