Antibodies

View as table Download

XRCC4 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human XRCC4

Rabbit anti-MRE11A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MRE11A

Rabbit anti-XRCC5 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human XRCC5

Rabbit polyclonal anti-DNA-PK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human DNA-PK.

Rabbit Polyclonal MRE11 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11.

Rabbit polyclonal antibody to Ku80 (XRCC5) (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining))

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 315 and 593 of Ku80 (Uniprot ID#P13010)

Rabbit polyclonal anti-XRCC6 / Ku70 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Ku70.

Rabbit Polyclonal Ku80 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal antibody to XRCC4 (X-ray repair complementing defective repair in Chinese hamster cells 4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 216 and 309 of XRCC4 (Uniprot ID#Q13426)

Rabbit polyclonal anti-XRCC6 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human XRCC6.

Rabbit polyclonal anti-FEN1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FEN1.

Rabbit polyclonal XRCC6 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This XRCC6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 521-548 amino acids from the C-terminal region of human XRCC6.

Rabbit polyclonal XRCC6 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This XRCC6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 228-254 amino acids from the Central region of human XRCC6.

Rabbit polyclonal XRCC5 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human XRCC5.

Rabbit Polyclonal Anti-Ku80 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Ku80 Antibody: A synthesized peptide derived from human Ku80

Rabbit Polyclonal Anti-Ku70 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ku70 Antibody: A synthesized peptide derived from human Ku70

Rabbit Polyclonal Anti-XRCC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XRCC4 Antibody: A synthesized peptide derived from human XRCC4

Rabbit Polyclonal Anti-Ku70 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ku70 Antibody: A synthesized peptide derived from human Ku70

Rabbit Polyclonal Anti-DNA-PK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNA-PK Antibody: A synthesized peptide derived from human DNA-PK

Rabbit Polyclonal Anti-MRE11A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MRE11A Antibody: A synthesized peptide derived from human MRE11A

Rabbit Polyclonal Anti-DNA PK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNA PK Antibody: A synthesized peptide derived from human DNA PK

Rabbit Polyclonal Anti-Ku70/80 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ku70/80 Antibody: A synthesized peptide derived from human Ku70/80

Rabbit Polyclonal Antibody against Mre11

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length human Mre11 protein

Rabbit polyclonal anti-XRCC6 / Ku70/80 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Ku70/80.
Modifications Phospho-specific

Rabbit polyclonal anti-XRCC4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human XRCC4.

Rabbit polyclonal DNA Polymerase lambda antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?.

Rabbit polyclonal anti-DNL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DNL4.

Anti-RAD50 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae)

Rabbit polyclonal XRCC5 Antibody (Center K439)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This XRCC5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-450 amino acids from the Central region of human XRCC5.

Rabbit anti-FEN1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FEN1

Rabbit Polyclonal Phospho-DNA-PK (Thr2647) Antibody (Phospho-specific)

Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human DNA-PK around the phosphorylation site of Threonine 2647
Modifications Phospho-specific

Rabbit Polyclonal RAD50 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal XRCC4 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal anti-RAD50 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD50.

Anti-LIG4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human ligase IV, DNA, ATP-dependent

Anti-PRKDC Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.2607~2611 (V-E-T-Q-A) derived from Human DNA-PK.

Rabbit polyclonal FEN1 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1.

Rabbit Polyclonal Anti-LIG4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIG4 antibody: synthetic peptide directed towards the N terminal of human LIG4. Synthetic peptide located within the following region: DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ

Rabbit Polyclonal Anti-DCLRE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the N terminal of human DCLRE1C. Synthetic peptide located within the following region: SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL

Rabbit polyclonal Anti-MRE11A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the N terminal of human MRE11A. Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM

Rabbit Polyclonal Antibody against RAD50 (zinc hook domain)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human Rad50 zinc hook region (amino acids 628-787) expressed in E. coli.

Goat Polyclonal Antibody against KU70 / XRCC6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence YKTEGDEEAEEEQ-C, from the N Terminus of the protein sequence according to NP_001460.1.

Goat Polyclonal Antibody against XRCC5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SLAKKDEKTDTLED, from the internal region of the protein sequence according to NP_066964.1.

Goat Anti-POLL / BETA-N Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-LGLPYREPAERDW, from the C Terminus of the protein sequence according to NP_037406.1.

Rabbit anti-PRKDC (DNA PKcs, Phospho-Thr2609) polyclonal antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanDNA PKcs around the phosphorylation site of threonine 2609 (V-E-TP-Q-A).
Modifications Phospho-specific

Rabbit polyclonal anti-Mre11 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corres-ponding to amino acids 68-706 of mouse Mre11 protein.

Rabbit polyclonal anti-Mre11 antibody

Applications IP
Reactivities Saccharomyces cerevisiae
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 578-590 of Saccharomyces cerevisiae (baker's yeast) Mre11 protein.

Rabbit polyclonal DNA PKcs pT 2609 antibody

Applications WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids surrounding Thr 2609 of human DNA PKcs.

Rabbit Polyclonal Anti-RAD50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAD50 Antibody is: synthetic peptide directed towards the N-terminal region of Human RAD50. Synthetic peptide located within the following region: SILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDF

Phospho-PRKDC-T2609 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T2609 of human PRKDC
Modifications Phospho-specific