Germany
Japan
United Kingdom
China
Antibodies
Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Active filters
Reactivities
- Rat
Clonalities
- Polyclonal
Families
- Druggable Genome
Filter by
Target Symbol
- AKT1 (47)
- EGFR (29)
- MAPT (29)
- JUN (21)
- RELA (21)
- IRS1 (20)
- ATF2 (19)
- CREB1 (19)
- CTNNB1 (19)
- RPS6KB1 (19)
- CDC25A (18)
- EZR (18)
- SMAD3 (18)
- SMAD1 (17)
- STAT1 (17)
- TP53 (17)
- ERBB2 (16)
- MAPK14 (16)
- NFKBIA (16)
- RAF1 (16)
- SMAD2 (16)
- HSP90AB1 (15)
- IGF1R (15)
- JAK2 (15)
- PRKCD (15)
- STAT3 (15)
- CANX (14)
- FOXO1 (14)
- GJA1 (14)
- HDAC2 (14)
- HSPD1 (14)
- MAP2K1 (14)
- SNCA (14)
- TH (14)
- APP (13)
- BAX (13)
- CASP3 (13)
- CHUK (13)
- FGFR1 (13)
- GSK3B (13)
- HDAC1 (13)
- MAPK1 (13)
- PAK1 (13)
- PTPN11 (13)
- SRC (13)
- CASP9 (12)
- CCNB1 (12)
- DOK1 (12)
- IKBKB (12)
- KDR (12)
- MET (12)
- NR3C1 (12)
- PTK2 (12)
- PXN (12)
- RB1 (12)
- STAT5B (12)
- SYK (12)
- BAD (11)
- BCL2L1 (11)
- BCL2L11 (11)
- BRAF (11)
- CHEK2 (11)
- FOS (11)
- GRIN1 (11)
- GSK3A (11)
- LCK (11)
- LRRK2 (11)
- MAP3K7 (11)
- MAPK8 (11)
- MYC (11)
- NGFR (11)
- NOS3 (11)
- NTRK2 (11)
- PDGFRB (11)
- ROCK2 (11)
- CASP6 (10)
- CDK2 (10)
- CSF1R (10)
- DNM1 (10)
- ESR1 (10)
- GRIN2B (10)
- MAP2K6 (10)
- MAPK3 (10)
- PDCD4 (10)
- PLCG1 (10)
- POMC (10)
- PRKAA1 (10)
- PRKCA (10)
- PRKD1 (10)
- RAB5A (10)
- RUNX1 (10)
- STAT5A (10)
- UCHL1 (10)
- VASP (10)
- AKT2 (9)
- CDK1 (9)
- CFL1 (9)
- DPYSL2 (9)
- ELK1 (9)
- GAB2 (9)
Applications
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (1290)
- MAPK signaling pathway (826)
- Focal adhesion (721)
- Metabolic pathways (610)
- Neurotrophin signaling pathway (604)
- Chemokine signaling pathway (583)
- Prostate cancer (581)
- Colorectal cancer (536)
- ErbB signaling pathway (517)
- Regulation of actin cytoskeleton (509)
- Neuroactive ligand-receptor interaction (502)
- Pancreatic cancer (493)
- Chronic myeloid leukemia (483)
- Insulin signaling pathway (464)
- T cell receptor signaling pathway (463)
- Cytokine-cytokine receptor interaction (408)
- Toll-like receptor signaling pathway (401)
- Calcium signaling pathway (396)
- Wnt signaling pathway (387)
- Apoptosis (377)
- Cell cycle (371)
- Glioma (370)
- Acute myeloid leukemia (365)
- Small cell lung cancer (365)
- Melanoma (364)
- Progesterone-mediated oocyte maturation (364)
- Endometrial cancer (362)
- B cell receptor signaling pathway (355)
- Fc gamma R-mediated phagocytosis (353)
- Jak-STAT signaling pathway (353)
- Adipocytokine signaling pathway (351)
- Non-small cell lung cancer (339)
- Adherens junction (336)
- VEGF signaling pathway (330)
- GnRH signaling pathway (329)
- Renal cell carcinoma (329)
- Fc epsilon RI signaling pathway (323)
- Leukocyte transendothelial migration (323)
- Alzheimer's disease (316)
- Endocytosis (308)
- Natural killer cell mediated cytotoxicity (303)
- Gap junction (299)
- Epithelial cell signaling in Helicobacter pylori infection (287)
- Axon guidance (279)
- TGF-beta signaling pathway (272)
- Amyotrophic lateral sclerosis (ALS) (264)
- Melanogenesis (264)
- Tight junction (259)
- Huntington's disease (245)
- Vascular smooth muscle contraction (244)
- Bladder cancer (242)
- Oocyte meiosis (242)
- Long-term potentiation (233)
- p53 signaling pathway (231)
- NOD-like receptor signaling pathway (226)
- Long-term depression (215)
- mTOR signaling pathway (200)
- Type II diabetes mellitus (185)
- RIG-I-like receptor signaling pathway (172)
- Pathogenic Escherichia coli infection (163)
- Thyroid cancer (152)
- Dilated cardiomyopathy (132)
- Hypertrophic cardiomyopathy (HCM) (132)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (128)
- Parkinson's disease (128)
- Ubiquitin mediated proteolysis (118)
- Basal cell carcinoma (114)
- Hematopoietic cell lineage (112)
- Cell adhesion molecules (CAMs) (109)
- Prion diseases (106)
- Purine metabolism (95)
- Cytosolic DNA-sensing pathway (94)
- Glycolysis / Gluconeogenesis (94)
- Antigen processing and presentation (92)
- Viral myocarditis (91)
- Dorso-ventral axis formation (89)
- Phosphatidylinositol signaling system (89)
- ECM-receptor interaction (85)
- Notch signaling pathway (82)
- PPAR signaling pathway (80)
- Vibrio cholerae infection (78)
- Complement and coagulation cascades (69)
- Primary immunodeficiency (68)
- Arginine and proline metabolism (67)
- Hedgehog signaling pathway (65)
- Base excision repair (59)
- Type I diabetes mellitus (58)
- Lysosome (57)
- Tyrosine metabolism (56)
- ABC transporters (55)
- Pyruvate metabolism (55)
- Inositol phosphate metabolism (54)
- Tryptophan metabolism (50)
- Fructose and mannose metabolism (48)
- Metabolism of xenobiotics by cytochrome P450 (46)
- Butanoate metabolism (45)
- Drug metabolism - cytochrome P450 (45)
- Valine (45)
- Fatty acid metabolism (44)
- Nucleotide excision repair (43)
- Systemic lupus erythematosus (42)
- Olfactory transduction (41)
- Alanine (40)
- Cardiac muscle contraction (40)
- Retinol metabolism (40)
- aspartate and glutamate metabolism (40)
- leucine and isoleucine degradation (40)
- Glycerolipid metabolism (39)
- Maturity onset diabetes of the young (39)
- Regulation of autophagy (39)
- Citrate cycle (TCA cycle) (35)
- Taste transduction (35)
- Pyrimidine metabolism (34)
- Renin-angiotensin system (34)
- Arachidonic acid metabolism (33)
- Proteasome (33)
- Homologous recombination (32)
- DNA replication (31)
- Mismatch repair (31)
- Propanoate metabolism (31)
- Cysteine and methionine metabolism (30)
- SNARE interactions in vesicular transport (30)
- Galactose metabolism (28)
- Histidine metabolism (28)
- Glutathione metabolism (27)
- Pentose phosphate pathway (27)
- Allograft rejection (25)
- Lysine degradation (25)
- beta-Alanine metabolism (25)
- Graft-versus-host disease (24)
- Phenylalanine metabolism (24)
- Nitrogen metabolism (23)
- Autoimmune thyroid disease (22)
- Starch and sucrose metabolism (22)
- Amino sugar and nucleotide sugar metabolism (21)
- Drug metabolism - other enzymes (21)
- Glycine (20)
- Non-homologous end-joining (20)
- RNA degradation (20)
- serine and threonine metabolism (20)
- Androgen and estrogen metabolism (19)
- Glycerophospholipid metabolism (19)
- Oxidative phosphorylation (18)
- Sphingolipid metabolism (18)
- Porphyrin and chlorophyll metabolism (17)
- Nicotinate and nicotinamide metabolism (15)
- Ascorbate and aldarate metabolism (12)
- Linoleic acid metabolism (12)
- Methane metabolism (12)
- Ribosome (12)
- Taurine and hypotaurine metabolism (12)
- Asthma (11)
- Folate biosynthesis (11)
- Limonene and pinene degradation (11)
- Riboflavin metabolism (11)
- Pentose and glucuronate interconversions (10)
- Circadian rhythm - mammal (9)
- Ether lipid metabolism (9)
- Glycosaminoglycan degradation (9)
- Glyoxylate and dicarboxylate metabolism (9)
- Synthesis and degradation of ketone bodies (9)
- Terpenoid backbone biosynthesis (9)
- Basal transcription factors (8)
- Fatty acid biosynthesis (8)
- Selenoamino acid metabolism (8)
- Spliceosome (7)
- C21-Steroid hormone metabolism (6)
- N-Glycan biosynthesis (6)
- One carbon pool by folate (6)
- leucine and isoleucine biosynthesis (6)
- Biosynthesis of unsaturated fatty acids (5)
- Pantothenate and CoA biosynthesis (5)
- Vitamin B6 metabolism (5)
- Aminoacyl-tRNA biosynthesis (4)
- Other glycan degradation (4)
- Primary bile acid biosynthesis (4)
- alpha-Linolenic acid metabolism (4)
- Caffeine metabolism (3)
- D-Glutamine and D-glutamate metabolism (3)
- Fatty acid elongation in mitochondria (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Glycosphingolipid biosynthesis - globo series (3)
- O-Glycan biosynthesis (3)
- Phenylalanine (3)
- tyrosine and tryptophan biosynthesis (3)
- Heparan sulfate biosynthesis (2)
- Steroid biosynthesis (2)
- Thiamine metabolism (2)
- Chondroitin sulfate biosynthesis (1)
- D-Arginine and D-ornithine metabolism (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- RNA polymerase (1)
- Sulfur metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)