MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal TET1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human TET1 protein (between residues 1700 to 1800) [UniProt Q8NFU7] |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal H3K9me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
TAZ Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human TAZ (NP_056287.1). |
| Modifications | Unmodified |
TAZ Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human TAZ (NP_056287.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YEATS4 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human YEATS4 (NP_006521.1). |
| Modifications | Unmodified |
YEATS4 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human YEATS4 (NP_006521.1). |
| Modifications | Unmodified |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal Anti-THOC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THOC1 antibody: synthetic peptide directed towards the C terminal of human THOC1. Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
TriMethyl-Histone H4-K20 Rabbit Polyclonal Antibody
| Applications | Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4 |
Rabbit Polyclonal Anti-HNRPL Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit Polyclonal H3K18ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K18ac antibody: the region of histone H3 containing the acetylated lysine 18 (H3K18ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3R17me2(asym)K18ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3R17me2(asym)K18ac antibody: the region of histone H3 containing the asymmetrically dimethylated R17 and the acetylated lysine 18 (H3R17me2(asym)K18ac), using a KLH-conjugated synthetic peptide. |
Germany
Japan
United Kingdom
China
