Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the C terminal of human STK3. Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit Polyclonal Anti-STK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STK3 antibody: synthetic peptide directed towards the N terminal of human STK3. Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal MKP-1/2 (Ser296/318) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MKP-1/2 around the phosphorylation site of Serine 296/318 |
| Modifications | Phospho-specific |
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Active filters
Clonalities
- Polyclonal
Pathways
- MAPK signaling pathway
Filter by
Target Symbol
- EGFR (81)
- AKT1 (61)
- RELA (52)
- TP53 (51)
- MAPT (43)
- JUN (27)
- RAF1 (27)
- MAP2K1 (26)
- CHUK (25)
- HSPB1 (25)
- MAPK14 (25)
- MYC (25)
- PAK1 (25)
- CASP3 (23)
- NFKB1 (23)
- ATF2 (22)
- FGFR1 (22)
- PDGFRB (22)
- MAPK8 (21)
- STMN1 (21)
- MAP3K5 (20)
- BRAF (19)
- IKBKG (19)
- CACNB2 (17)
- IKBKB (17)
- NTRK2 (17)
- EGF (16)
- FOS (16)
- PDGFB (16)
- PRKCA (16)
- MAPK3 (15)
- ATF4 (14)
- HSPA1A (14)
- MAPK1 (14)
- NFKB2 (14)
- AKT2 (13)
- ELK1 (13)
- FGF4 (13)
- NTRK1 (13)
- RPS6KA1 (13)
- BDNF (12)
- MAP3K7 (12)
- MECOM (12)
- MEF2C (12)
- NR4A1 (12)
- PRKCB (12)
- TNF (12)
- DDIT3 (11)
- DUSP1 (11)
- FAS (11)
- IL1B (11)
- JUND (11)
- MAP2K4 (11)
- PDGFA (11)
- TNFRSF1A (11)
- GRB2 (10)
- MAP2K6 (10)
- MAP3K8 (10)
- NFATC4 (10)
- RELB (10)
- RPS6KA5 (10)
- TGFBR2 (10)
- TRAF6 (10)
- CDC25B (9)
- FASLG (9)
- FGF2 (9)
- FGFR2 (9)
- MAP2K2 (9)
- MAPKAPK2 (9)
- NRAS (9)
- PDGFRA (9)
- SRF (9)
- TGFB1 (9)
- AKT3 (8)
- CRK (8)
- FGF1 (8)
- NGF (8)
- PAK2 (8)
- PPP3CA (8)
- PRKACA (8)
- TGFB2 (8)
- TGFBR1 (8)
- ARRB1 (7)
- CACNB1 (7)
- FGFR3 (7)
- HSPA8 (7)
- MAP2K3 (7)
- MKNK1 (7)
- NF1 (7)
- TRAF2 (7)
- CRKL (6)
- DUSP6 (6)
- FGF7 (6)
- FLNA (6)
- MAP3K14 (6)
- MAPKAPK5 (6)
- NFATC2 (6)
- PRKCG (6)
- TAB1 (6)
- ACVR1B (5)
Reactivities
- Human (1495)
- Mouse (1078)
- Rat (899)
- Bovine (47)
- Dog (42)
- Pig (37)
- Chicken (26)
- Cow (23)
- Monkey (23)
- Rabbit (16)
- Xenopus (14)
- Hamster (13)
- Rhesus Monkey (12)
- Canine (10)
- X. tropicalis (7)
- Drosophila (5)
- Primate (5)
- Sheep (5)
- Zebrafish (5)
- Horse (4)
- C. elegans (3)
- Feline (3)
- Guinea Pig (3)
- Bat (2)
- Canis (2)
- Chimpanzee (2)
- Equine (2)
- Beluga (1)
- Carp (1)
- Coral (1)
- Dogfish (1)
- Fish (1)
- Gerbil (1)
- Gibbon (1)
- Gorilla (1)
- Hagfish (1)
- Macaque (1)
- Porcine (1)
- Tobacco (1)
- Tobacco hornworm (1)
- Tomato (1)
- Yeast (1)
Applications
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1720)
- Protein Kinase (800)
- Transcription Factors (473)
- ES Cell Differentiation/IPS (386)
- Transmembrane (358)
- Secreted Protein (295)
- Adult stem cells (141)
- Stem cell - Pluripotency (118)
- Stem cell relevant signaling - JAK/STAT signaling pathway (106)
- Embryonic stem cells (85)
- Phosphatase (83)
- Cancer stem cells (81)
- Induced pluripotent stem cells (66)
- Ion Channels: Other (52)
- Stem cell relevant signaling - Wnt Signaling pathway (38)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (25)
- Protease (23)
- Ion Channels: Calcium (15)
- Nuclear Hormone Receptor (12)