Germany
Japan
United Kingdom
China
Antibodies
Download
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit Polyclonal MKP-1/2 (Ser296/318) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MKP-1/2 around the phosphorylation site of Serine 296/318 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PPP1R10 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R10 antibody: synthetic peptide directed towards the N terminal of human PPP1R10. Synthetic peptide located within the following region: SQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKP |
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit Polyclonal Anti-SYNJ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR |
Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit Polyclonal Anti-CTDSPL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
Rabbit Polyclonal Anti-PPP2R5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW |
Goat Polyclonal Anti-DUSP6 / MKP3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DUSP6 / MKP3 Antibody: Peptide with sequence C-PSNQNVYQVDSLQST, from the C Terminus of the protein sequence according to NP_001937.2; NP_073143.2. |
USD 524.00
In Stock
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
CDC25C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25C |
Rabbit anti-PPP2R1A Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP2R1A |
Rabbit anti-PPM1D Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPM1D |
Rabbit Polyclonal Anti-SYNJ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the middle region of human SYNJ1. Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP |
Rabbit Polyclonal Anti-DUSP22 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DUSP22 antibody is: synthetic peptide directed towards the N-terminal region of Human DUSP22. Synthetic peptide located within the following region: LPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADS |
Rabbit Polyclonal Anti-SYNJ2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNJ2 antibody: synthetic peptide directed towards the N terminal of human SYNJ2. Synthetic peptide located within the following region: SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL |
Rabbit Polyclonal Anti-MTMR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY |
SHP1 (PTPN6) mouse monoclonal antibody, clone PTY11, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Human
Families
- Phosphatase
Filter by
Target Symbol
- PTPRC (89)
- PTPRE (67)
- CTDSP1 (47)
- CDKN3 (46)
- PPM1B (46)
- SIRPA (34)
- DUSP5 (32)
- PTPN11 (30)
- PPP2R5D (28)
- PTPN1 (28)
- MTMR14 (26)
- DUSP1 (24)
- DUSP10 (24)
- DAPP1 (23)
- DUSP29 (20)
- MTMR2 (20)
- CDC25A (19)
- PPP4C (19)
- CDC25B (18)
- PPM1D (18)
- PPP2R1B (17)
- PTPN7 (16)
- PTEN (15)
- DUSP4 (14)
- CTDSP2 (13)
- PPP1R7 (12)
- PTPN6 (11)
- PPP1CA (10)
- PPP3CA (10)
- CDC25C (9)
- PTPN22 (9)
- ACPP (7)
- PPP1CB (7)
- PPP3CB (7)
- DUSP23 (6)
- DUSP3 (6)
- DUSP6 (6)
- DUSP8 (5)
- PPM1G (5)
- PPP2R1A (5)
- PPP4R4 (5)
- DUSP16 (4)
- DUSP22 (4)
- EPM2A (4)
- PPP1CC (4)
- PPP2CA (4)
- PSPH (4)
- PTP4A2 (4)
- PTPA (4)
- PTPN2 (4)
- PTPN5 (4)
- PTPRM (4)
- DUSP12 (3)
- DUSP19 (3)
- EYA1 (3)
- ILKAP (3)
- PDP2 (3)
- PNKP (3)
- PPP2R2A (3)
- PPP2R3A (3)
- PPP2R3B (3)
- PPP2R5A (3)
- PTN (3)
- PTP4A3 (3)
- PTPN13 (3)
- PTPRJ (3)
- PTPRR (3)
- SET (3)
- ACP1 (2)
- CDC14A (2)
- CILP (2)
- CTDP1 (2)
- DUSP13 (2)
- DUSP14 (2)
- DUSP26 (2)
- DUSP9 (2)
- EYA3 (2)
- INPP5K (2)
- MTMR7 (2)
- PPFIA1 (2)
- PPM1F (2)
- PPM1J (2)
- PPM1K (2)
- PPM1L (2)
- PPM1M (2)
- PPP1R1C (2)
- PPP1R3A (2)
- PPP2CB (2)
- PPP2R2B (2)
- PPP2R5B (2)
- PPP4R2 (2)
- PPP6C (2)
- PPTC7 (2)
- PTPN12 (2)
- PTPN20 (2)
- PTPN3 (2)
- PTPRK (2)
- SSH3 (2)
- SYNJ1 (2)
- CTDSPL (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- MAPK signaling pathway (228)
- T cell receptor signaling pathway (119)
- Oocyte meiosis (112)
- Cell adhesion molecules (CAMs) (93)
- Fc gamma R-mediated phagocytosis (89)
- Primary immunodeficiency (89)
- Wnt signaling pathway (82)
- Natural killer cell mediated cytotoxicity (60)
- Insulin signaling pathway (54)
- B cell receptor signaling pathway (53)
- Adherens junction (48)
- Cell cycle (48)
- Tight junction (48)
- Progesterone-mediated oocyte maturation (46)
- Jak-STAT signaling pathway (41)
- Long-term potentiation (40)
- Focal adhesion (36)
- Metabolic pathways (33)
- Riboflavin metabolism (33)
- p53 signaling pathway (33)
- Epithelial cell signaling in Helicobacter pylori infection (31)
- Adipocytokine signaling pathway (30)
- Chronic myeloid leukemia (30)
- Leukocyte transendothelial migration (30)
- Neurotrophin signaling pathway (30)
- Renal cell carcinoma (30)
- Long-term depression (28)
- TGF-beta signaling pathway (28)
- Fructose and mannose metabolism (24)
- Thiamine metabolism (24)
- Regulation of actin cytoskeleton (23)
- Vascular smooth muscle contraction (21)
- Inositol phosphate metabolism (20)
- Phosphatidylinositol signaling system (20)
- Alzheimer's disease (19)
- Amyotrophic lateral sclerosis (ALS) (19)
- Apoptosis (19)
- Axon guidance (19)
- Calcium signaling pathway (19)
- VEGF signaling pathway (19)
- Endometrial cancer (15)
- Glioma (15)
- Melanoma (15)
- Pathways in cancer (15)
- Prostate cancer (15)
- Small cell lung cancer (15)
- Glycine (4)
- serine and threonine metabolism (4)
- Sphingolipid metabolism (1)
- Type I diabetes mellitus (1)