Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Anti-LDHB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
Anti-ADH5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit Polyclonal Anti-DLAT Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT. Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR |
Rabbit Polyclonal Anti-PKM2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the middle region of human PKM2. Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ |
Rabbit Polyclonal Anti-ENO3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN |
Chicken Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GAPDH antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human GAPDH. The immunogen is located within amino acids 230 - 280 of GAPDH. |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
Rabbit Polyclonal Anti-PKLR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE |
Rabbit polyclonal anti-HK1 (HXK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HXK1. |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV |
Rabbit Polyclonal Anti-ADH1B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV |
Rabbit Polyclonal Anti-PGK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGK1 antibody: synthetic peptide directed towards the C terminal of human PGK1. Synthetic peptide located within the following region: ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR |
Rabbit Polyclonal Anti-ENO3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR |
Active filters
Pathways
- Glycolysis / Gluconeogenesis
Filter by
Category
Target Symbol
- GAPDH (59)
- PGAM2 (55)
- ACSS2 (53)
- AKR1A1 (52)
- PFKP (52)
- PKLR (44)
- DLD (41)
- ALDH3A2 (36)
- ADH1B (35)
- GPI (34)
- ENO2 (32)
- PGAM4 (31)
- ADH5 (30)
- LDHA (30)
- ALDOB (24)
- GALM (22)
- ALDH1A3 (20)
- PDHA1 (20)
- ADH7 (18)
- PKM (18)
- ALDH3A1 (17)
- HK2 (17)
- ALDH2 (13)
- ENO1 (13)
- ALDH3B1 (12)
- ALDH7A1 (11)
- GCK (10)
- PCK1 (10)
- ALDOA (9)
- PFKL (8)
- PGAM1 (8)
- ALDH9A1 (7)
- HK1 (7)
- LDHB (7)
- ENO3 (6)
- FBP2 (6)
- G6PC1 (6)
- TPI1 (6)
- ADH1A (5)
- ADH4 (5)
- ALDOC (5)
- FBP1 (5)
- PFKM (5)
- PGK1 (5)
- ALDH1B1 (4)
- ALDH3B2 (4)
- BPGM (4)
- DLAT (3)
- HK3 (3)
- LDHC (3)
- ADH6 (2)
- G6PC (2)
- LDHAL6A (2)
- PCK2 (2)
- PDHA2 (2)
- PGK2 (2)
- PGM1 (2)
- ACSS1 (1)
- ALDEHYDE DEHYDROGENASE 10 (1)
- LDHAL6B (1)
- PDHB (1)
- PGM2 (1)
- PYRUVATE DEHYDROGENASE E2 (1)
Reactivities
- Human (867)
- Mouse (655)
- Rat (644)
- Monkey (94)
- Dog (72)
- Bovine (15)
- Chicken (14)
- Pig (14)
- Cow (13)
- Rabbit (9)
- Xenopus (7)
- Canine (4)
- Chimpanzee (4)
- Drosophila (4)
- Porcine (4)
- Yeast (4)
- Feline (3)
- Rhesus Monkey (3)
- X. tropicalis (3)
- Zebrafish (3)
- Avian (2)
- Bacteria (2)
- Hamster (2)
- Insect (2)
- Primate (2)
- All Species (1)
- Goat (1)
- Guinea Pig (1)
- Invertebrate (1)
- Protozoa (1)