Germany
Japan
United Kingdom
China
Antibodies
Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-NNMT antibody for SISCAPA, clone OTIR1F6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-P5CR1 antibody for SISCAPA, clone OTIR1E8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-BHMT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE |
USD 379.00
In Stock
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
USD 379.00
In Stock
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BHMT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT |
Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1. |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Pathways
- Metabolic pathways
Filter by
Target Symbol
- NME1 (168)
- OTC (127)
- PIK3C2A (110)
- TYMS (85)
- LTA4H (65)
- ABAT (60)
- SMS (59)
- ACAT2 (56)
- RRM1 (56)
- ACY1 (53)
- PFKP (52)
- AKR1A1 (51)
- ATP6V1C2 (51)
- NDUFA7 (51)
- PGAM2 (51)
- PPAT (51)
- RPN1 (51)
- ACSS2 (50)
- HADH (50)
- TH (50)
- AK4 (48)
- GCH1 (48)
- ALOX5 (47)
- ASS1 (47)
- CMPK1 (46)
- AK5 (45)
- NANP (45)
- PYCR2 (45)
- UCK1 (45)
- ACAA2 (42)
- GAPDH (42)
- AMDHD1 (40)
- ARG1 (40)
- GRHPR (40)
- PKLR (40)
- UPRT (39)
- DLD (37)
- GBE1 (35)
- PAFAH1B3 (35)
- PISD (35)
- AK1 (33)
- GBA (33)
- NDUFB9 (32)
- SHMT2 (32)
- POLR2H (31)
- ALDH3A2 (30)
- GPI (30)
- MMAB (30)
- PAPSS2 (30)
- SDHB (30)
- HMBS (29)
- ADH5 (28)
- HAO1 (28)
- NNMT (27)
- CYP2A6 (26)
- GSS (26)
- MTHFR (26)
- BHMT (25)
- HIBCH (25)
- HSD17B10 (25)
- IDH1 (25)
- ACO2 (24)
- ALDOB (24)
- MPI (23)
- ATP5F1B (22)
- COX17 (22)
- GAD1 (22)
- PIKFYVE (22)
- ATP6V1B1 (21)
- PAICS (21)
- SCP2 (21)
- TALDO1 (21)
- UQCRC1 (21)
- ALDH1A3 (20)
- DDOST (20)
- MTMR2 (20)
- NDUFA4L2 (20)
- OXSM (20)
- PNPO (20)
- PRDX6 (20)
- TDO2 (20)
- ATIC (19)
- CAT (19)
- ENO2 (18)
- FH (18)
- HPRT1 (18)
- GLS2 (17)
- POLR2A (17)
- ACADM (16)
- ASL (16)
- B3GNT2 (16)
- BDH2 (16)
- HSD17B4 (16)
- IDH3A (16)
- KYNU (16)
- PHGDH (16)
- POLR2E (16)
- ADH7 (15)
- AMT (15)
- ATP6V1F (15)