Collagen I (COL1A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Immunogen | Collagen type I purified from Human and Bovine placenta. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Immunogen | Collagen type I purified from Human and Bovine placenta. |
GFP rabbit polyclonal antibody
Applications | ELISA, IP, WB |
Reactivities | A. victoria |
Immunogen | E.coli expressed full-length GFP (Green Fluorescent Protein). |
Rabbit polyclonal antibody to CACNA1B (calcium channel, voltage-dependent, N type, alpha 1B subunit)
Applications | IF, IP, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 2013 and 2209 of CACNA1B (Uniprot ID#Q00975) |
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mouse, Rat, Sheep |
Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Immunogen | Collagen type I purified from Human and Bovine placenta. |
GFP rabbit polyclonal antibody, Purified
Applications | IF, IP, WB |
Reactivities | All Species |
Immunogen | EGFP, a native full-length protein |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
Conjugation | Biotin |
Immunogen | Collagen Type I from Human and Bovine placenta. |
PGK1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bakers Yeast |
Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit anti-IRF3 Polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IRF3 |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Thermolysin rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bacillus sp. |
Immunogen | Thermolysin isolated and purified from Bacillus thermoproteolyticus rokko. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
OVAL rabbit polyclonal antibody, Biotin, Purified
Applications | ELISA, IP, WB |
Reactivities | Chicken |
Conjugation | Biotin |
Immunogen | Native Ovalbumin from hen egg white |
Osteopontin (SPP1) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IHC, IP, WB |
Reactivities | Canine, Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide corresponding to Human Osteopontin conjugated to KLH using maleimide. |
PPP4C Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP4C |
Rabbit Polyclonal Anti-HNRPA0 Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Ku70 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
Modifications | Unmodified |
Ku70 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
Modifications | Unmodified |
Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human, Mammalian |
Immunogen | Collagen type IV purified from Human and Bovine placenta. |
YAP1 Rabbit polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
Modifications | Unmodified |
Rabbit Polyclonal H3K27me3S28p Antibody
Applications | Dot, ELISA, IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3S10p Antibody
Applications | Dot, ELISA, IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide. |
TDH1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bakers Yeast |
Immunogen | Glyceraldehyde-3-Phosphate Dehydrogenase isolated and purified from Baker's Yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-HNRPL Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
Hepatitis B X Protein / HBx rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IP, WB |
Immunogen | Recombinant Hepatitis B Protein X from E. coli. |
Rabbit anti-Histone H4K20me2 Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4 |
Rabbit anti-RNF2 Polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RNF2 |
Rabbit Polyclonal Anti-EIF3G Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EIF3G antibody: synthetic peptide directed towards the middle region of human EIF3G. Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR |
Collagen III (COL3A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human |
Immunogen | Collagen Type III from Human and Bovine placenta |
Amyloid Fibrils (OC) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Fibrils prepared from Human Aß42 peptide. |
OVAL rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Chicken |
Immunogen | Ovalbumin from Hen Egg White (native protein) |
HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
HK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK1 |
Rabbit anti-ARRB1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ARRB1 |
Rabbit Polyclonal Anti-ARF1 Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA |
Phospho-VASP-S157 Rabbit polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S157 of human Phospho-VASP-S157 (NP_003361.1). |
Modifications | Phospho S157 |
Caspase 1 (CASP1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide surrounding amino acid 132 of Human Caspase-1. |
PGI1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bakers Yeast |
Immunogen | Phosphoglucose isomerase isolated and purified from baker’s yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit anti-GDF15 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GDF15 |
Asialoganglioside GM1 rabbit polyclonal antibody, Ig Fraction
Applications | Assay, CT, FC, FN, IHC, IP |
Reactivities | Mouse, Rat |
Immunogen | Asialo GM1 purified from Bovine brain tissue, methylated BSA and complete Freund's adjuvant. |
Collagen III (COL3A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Bovine, Human |
Immunogen | Collagen type III purified from Human and Bovine placenta. |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit Polyclonal RBBP6 Antibody
Applications | IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human RBBP6 protein (between residues 1600-1650) [UniProt Q7Z6E9] |
Rabbit anti-SHMT2 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SHMT2 |
Rabbit anti-DBI Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DBI |