Germany
Japan
United Kingdom
China
Products
Download
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit Polyclonal Anti-MGP
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGP antibody: synthetic peptide directed towards the middle region of human MGP. Synthetic peptide located within the following region: INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM |
Rabbit Polyclonal Anti-RFX1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RFX1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human RFX1. The immunogen is located within the last 50 amino acids of RFX1. |
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Rat |
| Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Rabbit polyclonal antibody to QSOX1 (quiescin Q6 sulfhydryl oxidase 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 231 and 617 of QSOX1 (Uniprot ID#O00391) |
Rabbit anti-GHRH Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GHRH |
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
USD 475.00
5 Days
Rabbit Polyclonal Anti-DEAF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DEAF1 antibody: synthetic peptide directed towards the N terminal of human DEAF1. Synthetic peptide located within the following region: EEPVLSRDEDSEEDADSEAERETPRVTAVAVMAAEPGHMDMGAEALPGPD |
Rabbit Polyclonal Anti-AGER Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Rabbit Polyclonal Anti-PTHLH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS |
Rabbit Polyclonal Anti-ASPN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASPN antibody: synthetic peptide directed towards the middle region of human ASPN. Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Active filters
Antibody Hosts
- Rabbit
Families
- Secreted Protein
Filter by
Target Symbol
- EGFR (79)
- AMH (39)
- NPPB (28)
- SYT1 (16)
- RBP4 (15)
- CALR (14)
- ERBB3 (14)
- EPOR (13)
- FGF4 (13)
- GCG (13)
- IL4 (13)
- MUC1 (13)
- CXCL12 (12)
- FLT1 (12)
- GDF15 (12)
- GNAS (12)
- IGF1 (12)
- LOX (12)
- MMP1 (12)
- NRG1 (12)
- ACE2 (11)
- AFP (11)
- C2 (11)
- FN1 (11)
- IL2 (11)
- IL7 (11)
- LEP (11)
- SPP1 (11)
- TNFSF13 (11)
- VEGFA (11)
- AGT (10)
- BDNF (10)
- CCL2 (10)
- FAS (10)
- IFNB1 (10)
- IGFBP1 (10)
- IL1B (10)
- IL9 (10)
- PLAC1 (10)
- SERPINB5 (10)
- TFF2 (10)
- TNFRSF11B (10)
- TNFRSF1A (10)
- AGR2 (9)
- DCN (9)
- FGF2 (9)
- GABBR1 (9)
- IFNG (9)
- IL16 (9)
- KLK3 (9)
- NGF (9)
- PLG (9)
- STX1A (9)
- SYP (9)
- TGFB1 (9)
- TIMP4 (9)
- TNF (9)
- TNFRSF1B (9)
- VEGFB (9)
- WNT1 (9)
- AGER (8)
- CALCA (8)
- CCL28 (8)
- CD40 (8)
- CD8A (8)
- CRP (8)
- CSF2 (8)
- DKK1 (8)
- EDA (8)
- EFEMP1 (8)
- F13A1 (8)
- FASLG (8)
- FGF1 (8)
- FGFR2 (8)
- HSD17B13 (8)
- IL19 (8)
- IL1RN (8)
- PGF (8)
- PTHLH (8)
- SERPINA1 (8)
- TGFB2 (8)
- TIMP1 (8)
- TIMP3 (8)
- WNT5B (8)
- A1BG (7)
- ADAMTS5 (7)
- AMPH (7)
- ANGPT2 (7)
- ANXA2 (7)
- APOE (7)
- BMP3 (7)
- CHGA (7)
- CLU (7)
- CSF1 (7)
- DKK3 (7)
- EPHA3 (7)
- ERAP1 (7)
- FGB (7)
- FOLR1 (7)
- FST (7)
Reactivities
- Human (2865)
- Mouse (1222)
- Rat (975)
- Bovine (64)
- Monkey (40)
- Pig (34)
- Rabbit (30)
- Dog (28)
- Chicken (23)
- Horse (20)
- Hamster (18)
- Bat (16)
- Gorilla (16)
- Gibbon (15)
- Primate (13)
- Mammalian (11)
- Porcine (8)
- Chimpanzee (6)
- Guinea Pig (6)
- Xenopus (6)
- Canine (5)
- Macaque (5)
- Rhesus Monkey (5)
- Sheep (4)
- Equine (3)
- Opossum (3)
- Orang-Utan (3)
- Zebrafish (3)
- Cow (2)
- Feline (2)
- Goat (2)
- Amphibian (1)
- Birds (1)
- Drosophila (1)
- Fish (1)
- Pufferfish (1)
- SimianIVE (1)
Applications
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Assay Platforms
Pathways
- Cytokine-cytokine receptor interaction (796)
- Pathways in cancer (445)
- Jak-STAT signaling pathway (282)
- MAPK signaling pathway (276)
- Focal adhesion (213)
- Regulation of actin cytoskeleton (189)
- Complement and coagulation cascades (170)
- Melanoma (168)
- TGF-beta signaling pathway (161)
- Hematopoietic cell lineage (158)
- Pancreatic cancer (143)
- Chemokine signaling pathway (141)
- Bladder cancer (132)
- Hedgehog signaling pathway (131)
- Endocytosis (125)
- Wnt signaling pathway (124)
- GnRH signaling pathway (123)
- Prostate cancer (119)
- ErbB signaling pathway (118)
- Melanogenesis (117)
- Basal cell carcinoma (109)
- Toll-like receptor signaling pathway (109)
- Calcium signaling pathway (105)
- Colorectal cancer (101)
- Glioma (97)
- Allograft rejection (96)
- Epithelial cell signaling in Helicobacter pylori infection (96)
- Gap junction (92)
- Non-small cell lung cancer (85)
- Autoimmune thyroid disease (84)
- Type I diabetes mellitus (83)
- T cell receptor signaling pathway (82)
- Adherens junction (79)
- Dorso-ventral axis formation (79)
- Endometrial cancer (79)
- ECM-receptor interaction (78)
- Neuroactive ligand-receptor interaction (75)
- Metabolic pathways (74)
- Asthma (71)
- Graft-versus-host disease (70)
- Apoptosis (69)
- Systemic lupus erythematosus (69)
- NOD-like receptor signaling pathway (68)
- Natural killer cell mediated cytotoxicity (67)
- Renal cell carcinoma (64)
- Cytosolic DNA-sensing pathway (60)
- Dilated cardiomyopathy (56)
- Fc epsilon RI signaling pathway (56)
- Hypertrophic cardiomyopathy (HCM) (56)
- Adipocytokine signaling pathway (55)
- Alzheimer's disease (52)
- RIG-I-like receptor signaling pathway (52)
- mTOR signaling pathway (52)
- p53 signaling pathway (51)
- Prion diseases (49)
- Antigen processing and presentation (47)
- Axon guidance (42)
- PPAR signaling pathway (42)
- Long-term depression (41)
- Neurotrophin signaling pathway (35)
- Renin-angiotensin system (35)
- Small cell lung cancer (33)
- Primary immunodeficiency (30)
- Cell adhesion molecules (CAMs) (29)
- Amyotrophic lateral sclerosis (ALS) (28)
- Cell cycle (28)
- Regulation of autophagy (24)
- Vascular smooth muscle contraction (24)
- VEGF signaling pathway (23)
- Chronic myeloid leukemia (22)
- Type II diabetes mellitus (18)
- Oocyte meiosis (16)
- Progesterone-mediated oocyte maturation (16)
- Viral myocarditis (16)
- Arachidonic acid metabolism (15)
- Ether lipid metabolism (15)
- Glycerolipid metabolism (14)
- Fc gamma R-mediated phagocytosis (13)
- Glycerophospholipid metabolism (12)
- Leukocyte transendothelial migration (12)
- Linoleic acid metabolism (12)
- SNARE interactions in vesicular transport (12)
- Taste transduction (12)
- Vibrio cholerae infection (12)
- alpha-Linolenic acid metabolism (12)
- Huntington's disease (10)
- Glycosaminoglycan degradation (9)
- Proteasome (9)
- Maturity onset diabetes of the young (8)
- Glycosphingolipid biosynthesis - lacto and neolacto series (7)
- Histidine metabolism (7)
- Starch and sucrose metabolism (7)
- Acute myeloid leukemia (6)
- Folate biosynthesis (5)
- N-Glycan biosynthesis (5)
- Pathogenic Escherichia coli infection (5)
- Purine metabolism (5)
- Pyrimidine metabolism (5)
- Tyrosine metabolism (5)
- Amino sugar and nucleotide sugar metabolism (4)
- Arginine and proline metabolism (4)
- Insulin signaling pathway (4)
- Keratan sulfate biosynthesis (4)
- O-Glycan biosynthesis (4)
- Riboflavin metabolism (4)
- Tryptophan metabolism (4)
- Glutathione metabolism (3)
- Nitrogen metabolism (3)
- beta-Alanine metabolism (3)
- Galactose metabolism (2)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Glycosphingolipid biosynthesis - globo series (2)
- Lysosome (2)
- Other glycan degradation (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)