Products

Download

Peroxidase Conjugated Affinity Purified Goat anti-Mouse IgG [H&L]

Applications WB: 1: 1,000; ICC: 1:200; IP: 1:200
Reactivities Mouse IgG
Conjugation HRP
Immunogen Mouse IgG, whole molecule

DDK Rabbit monoclonal antibody,clone OTIR5G2, recognizes both N-terminal and C-terminal DDK tags

Applications ELISA, IP, WB
Conjugation Unconjugated

Anti-DDK (FLAG) rabbit polyclonal antibody

Applications IP, WB
Immunogen A synthetic peptide (DYKDDDDK) coupled to KLH

Rabbit polyclonal eGFP antibody

Applications IF, IP, WB
Immunogen Recombinant full length protein of eGFP (1-265aa)

Anti-HA tag rabbit polyclonal antibody

Applications IF, IP, WB
Immunogen Synthetic peptide contain a sequence corresponding to a region of HA Tag

DDK Rabbit monoclonal antibody,clone OTIR5G2, recognizes both N-terminal and C-terminal DDK tags

Applications ELISA, IP, WB
Conjugation Unconjugated

Anti-6X His tag rabbit polyclonal antibody

Applications ELISA, IP, WB
Immunogen Rabbit Polyclonal antibody to 6X His tag

Rabbit polyclonal antibody to CACNA1B (calcium channel, voltage-dependent, N type, alpha 1B subunit)

Applications IF, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 2013 and 2209 of CACNA1B (Uniprot ID#Q00975)

Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mouse, Rat, Sheep
Immunogen Collagen type II purified from Human knee and Bovine nasal cartilage.

Pdpn hamster monoclonal antibody, clone 811, Purified

Applications IHC, IP, WB
Reactivities Mouse

PGK1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bakers Yeast
Immunogen 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3

DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3

Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3

Rabbit anti-IRF3 Polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IRF3

Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG

Thermolysin rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bacillus sp.
Immunogen Thermolysin isolated and purified from Bacillus thermoproteolyticus rokko.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C

Rabbit Polyclonal Anti-HNRPA0 Antibody

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA0 antibody: synthetic peptide directed towards the middle region of human HNRPA0. Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG

Rabbit Polyclonal Anti-HNRPUL1 Antibody

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ

Ku70 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1).
Modifications Unmodified

Ku70 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1).
Modifications Unmodified

YAP1 Rabbit polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Modifications Unmodified

YAP1 Rabbit polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Modifications Unmodified

Rabbit Polyclonal H3K27me3S28p Antibody

Applications Dot, ELISA, IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K27me3S28p antibody: histone H3 containing the trimethylated lysine 27 and the phosphorylated serine 28 (H3K27me3S28p), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3S10p Antibody

Applications Dot, ELISA, IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-H3S10p antibody: histone H3 containing the phosphorylated serine 10 (H3S10p), using a KLH-conjugated synthetic peptide.

TDH1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bakers Yeast
Immunogen Glyceraldehyde-3-Phosphate Dehydrogenase isolated and purified from Baker's Yeast.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Anti-HNRPL Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV

Monkey IgG (Fc specific) goat polyclonal antibody, FITC

Applications Can be used:
• In direct staining of cytoplasmic IgG in fixed Monkey cells and tissue substrates.
• To identify circulating IgG antibodies in serodiagnostic microbiology and autoimmune diseases.
• To identify a specific antigen or immune complex using a reference antibody of Monkey in the middle layer of the test procedure.
This immunoconjugate is not pre-diluted. The optimum working dilution of each conjugate should be established by titration before being used. Excess labelled antibody must be avoided because it may cause high unspecific background staining and interfere with the specific signal.
Recommended Working Dilution: 1/20-1/80.
Reactivities Monkey
Conjugation FITC
Immunogen Purified normal IgG isolated from pooled Rhesus Monkey serum. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit anti-Histone H4K20me2 Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic methylated peptide corresponding to residues surrounding K20 of human histone H4

Rabbit anti-RNF2 Polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RNF2

Rabbit Polyclonal Anti-EIF3G Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF3G antibody: synthetic peptide directed towards the middle region of human EIF3G. Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR

Amyloid Fibrils (OC) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human
Immunogen Fibrils prepared from Human Aß42 peptide.

OVAL rabbit polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Chicken
Immunogen Ovalbumin from Hen Egg White (native protein)

HDAC1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N term -peptide of human HDAC1

HK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK1

Rabbit anti-ARRB1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ARRB1

Anti-GST rabbit polyclonal antibody

Applications IP, WB
Immunogen Rabbits were immunized with recombinant Glutathione-S-transferase (GST) from E.coli . After multiple immunizations in Freund's adjuvant serum was collected. Antibodies were immunoaffinity purified using GST immobilized on a solid support.

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Phospho-VASP-S157 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S157 of human Phospho-VASP-S157 (NP_003361.1).
Modifications Phospho S157

Herpes Virus Type 8 / HHV8 Cyclin sheep polyclonal antibody, Purified

Applications IP, WB
Reactivities Human
Immunogen Inclusion Bodies from E. Coli expressing His-tagged full length Human Cyclin G2 protein.

PGI1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bakers Yeast
Immunogen Phosphoglucose isomerase isolated and purified from baker’s yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70)

Rabbit anti-GDF15 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GDF15

Asialoganglioside GM1 rabbit polyclonal antibody, Ig Fraction

Applications Assay, CT, FC, FN, IHC, IP
Reactivities Mouse, Rat
Immunogen Asialo GM1 purified from Bovine brain tissue, methylated BSA and complete Freund's adjuvant.

Collagen III (COL3A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human
Immunogen Collagen type III purified from Human and Bovine placenta.

Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926)

Rabbit anti-SHMT2 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SHMT2

Rabbit anti-DBI Polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human DBI

Rabbit anti-LITAF Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human LITAF