Germany
Japan
United Kingdom
China
PRKAB1 (untagged)-Human protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Products
View as table DownloadPDE3A (untagged)-Human phosphodiesterase 3A, cGMP-inhibited (PDE3A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PRKAG1 (untagged)-Human protein kinase, AMP-activated, gamma 1 non-catalytic subunit (PRKAG1), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GCK (untagged)-Human glucokinase (hexokinase 4, maturity onset diabetes of the young 2), transcript variant 1 (cDNA clone MGC:1742 IMAGE:3536582), complete cds
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CBL (untagged)-Human Cas-Br-M (murine) ecotropic retroviral transforming sequence (CBL)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
AKT1 (untagged)-Human v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PKLR (untagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Antibody against PYGM (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PYGM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 698-727 amino acids from the C-terminal region of human PYGM. |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
SHC1 (untagged)-Human SHC (Src homology 2 domain containing) transforming protein 1 (SHC1), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C). |
| Modifications | Phospho-specific |
Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PRKAR2A (untagged)-Human protein kinase, cAMP-dependent, regulatory, type II, alpha (PRKAR2A)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PRKACA (untagged)-Human protein kinase, cAMP-dependent, catalytic, alpha (PRKACA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CRK (untagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant I
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MAP2K1 (untagged)-Kinase deficient mutant (K97M) of Human mitogen-activated protein kinase kinase 1 (MAP2K1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CRK (untagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant II
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC324918 is the updated version of SC114134.
USD 345.00
In Stock
Rabbit polyclonal anti-KAP0 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0. |
Rabbit Polyclonal IRS-1 (Ser307) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IRS-1 around the phosphorylation site of Serine 307 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit anti-MTOR polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
PRKCI (untagged)-Human protein kinase C, iota (PRKCI)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PRKCZ (untagged)-Human protein kinase C, zeta (PRKCZ), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PRKCZ (untagged)-Human protein kinase C, zeta (PRKCZ), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SHC1 (untagged)-Human SHC (Src homology 2 domain containing) transforming protein 1 (SHC1), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
Anti-FOXO1 (Phospho-Ser256) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 256 (A-A-S(p)-M-D) derived from Human FKHR. |
| Modifications | Phospho-specific |
Anti-JNK1 (JNK1) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-JNK1 (JNK1) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 159.00
In Stock
Active filters
Pathways
- Insulin signaling pathway
Citations
- Yes
Filter by
Target Symbol
- AKT1 (10)
- KRAS (10)
- MAPK1 (8)
- NRAS (7)
- MAP2K1 (6)
- MAPK8 (6)
- BRAF (5)
- FOXO1 (5)
- HK2 (5)
- PIK3R1 (5)
- PPARGC1A (5)
- PRKCZ (5)
- SHC1 (5)
- SOCS3 (5)
- AKT3 (4)
- HRAS (4)
- INS (4)
- IRS1 (4)
- MAPK3 (4)
- PIK3CA (4)
- PRKACA (4)
- PRKAR1A (4)
- SOCS2 (4)
- CRK (3)
- CRKL (3)
- ELK1 (3)
- G6PC (3)
- MTOR (3)
- SOCS1 (3)
- ARAF (2)
- CBL (2)
- CBLB (2)
- EIF4E (2)
- EIF4EBP1 (2)
- GCK (2)
- GRB2 (2)
- GSK3B (2)
- PDE3B (2)
- PKLR (2)
- PPP1CC (2)
- PRKAA2 (2)
- PRKAR2A (2)
- PRKCI (2)
- RAF1 (2)
- RHEB (2)
- RPS6KB1 (2)
- SREBF1 (2)
- ACACA (1)
- AKT2 (1)
- BAD (1)
- CALM1 (1)
- EXOC7 (1)
- FASN (1)
- FBP1 (1)
- FLOT1 (1)
- G6PC2 (1)
- INSR (1)
- IRS2 (1)
- IRS4 (1)
- MAP2K2 (1)
- MKNK2 (1)
- PDE3A (1)
- PDPK1 (1)
- PHKA2 (1)
- PI 3 KINASE CATALYTIC SUBUNIT ALPHA (1)
- PIK3CD (1)
- PIK3CG (1)
- PIK3R2 (1)
- PPP1CA (1)
- PPP1CB (1)
- PRKAA1 (1)
- PRKAB1 (1)
- PRKACB (1)
- PRKAG1 (1)
- PRKAR2B (1)
- PYGL (1)
- PYGM (1)
- SHC3 (1)
- SLC2A4 (1)
- SORBS1 (1)
- SOS2 (1)
- TRIP10 (1)