E3 12.5K (AC_000017) Virus Tagged ORF Clone
CAT#: VC100022
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for E3 125K [Human adenovirus 1], codon optimized for human cell expression, AP_000519
View other clones from "Virus" (34)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | E3 12.5K |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100022 represents NCBI reference of AP_000519 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACCTCAGGTGAAGCAGAGCAGCTGAGACTTACACATCTGGATCATTGTAGAAGGCACAAATGTTTTG CGCGCGGCAGTGGAGAGTTTTGCTACTTTGAGCTGCCCGAGGAACACATCGAAGGACCAGCTCATGGGGT CCGCCTCACTACTCAAGTAGAGCTGACAAGATCACTGATCAGAGAGTTCACACTGAGACCTCTTCTGGTG GAGAGAGAAAGAGGGCCTTGCGTGCTCACCGTCGTGTGCAACTGTCCCAACCCCGGCCTTCACCAGGATC TTTGTTGCCATCTGTGTACCGAATATAACAAGTATCGCAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100022 representing AP_000519
Red=Cloning sites Green=Tags MTSGEAEQLRLTHLDHCRRHKCFARGSGEFCYFELPEEHIEGPAHGVRLTTQVELTRSLIREFTLRPLLV ERERGPCVLTVVCNCPNPGLHQDLCCHLCTEYNKYRN TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | AC_000017 |
ORF Size | 321 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | AC_000017.1, AP_000519 |
RefSeq ORF | 321 |
MW | 12.4 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100001 | Myc-DDK-tagged ORF clone of viral ORF for E1A [Human adenovirus 1], codon optimized for human cell expression, AP_000498 |
USD 400.00 |
|
VC100002 | Myc-DDK-tagged ORF clone of viral ORF for E1B 19K [Human adenovirus 1], codon optimized for human cell expression, AP_000499 |
USD 400.00 |
|
VC100003 | Myc-DDK-tagged ORF clone of viral ORF for E1B 55K [Human adenovirus 1], codon optimized for human cell expression, AP_000500 |
USD 640.00 |
|
VC100004 | Myc-DDK-tagged ORF clone of viral ORF for IX [Human adenovirus 1], codon optimized for human cell expression, AP_000501 |
USD 400.00 |
|
VC100005 | Myc-DDK-tagged ORF clone of viral ORF for IVa2 [Human adenovirus 1], codon optimized for human cell expression, AP_000502 |
USD 580.00 |
|
VC100007 | Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus 1], codon optimized for human cell expression, AP_000504 |
USD 1,070.00 |
|
VC100008 | Myc-DDK-tagged ORF clone of viral ORF for 52K [Human adenovirus 1], codon optimized for human cell expression, AP_000505 |
USD 540.00 |
|
VC100009 | Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus 1], codon optimized for human cell expression, AP_000506 |
USD 740.00 |
|
VC100010 | Myc-DDK-tagged ORF clone of viral ORF for III [Human adenovirus 1], codon optimized for human cell expression, AP_000507 |
USD 730.00 |
|
VC100011 | Myc-DDK-tagged ORF clone of viral ORF for pVII [Human adenovirus 1], codon optimized for human cell expression, AP_000508 |
USD 400.00 |
|
VC100012 | Myc-DDK-tagged ORF clone of viral ORF for V [Human adenovirus 1], codon optimized for human cell expression, AP_000509 |
USD 460.00 |
|
VC100013 | Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus 1], codon optimized for human cell expression, AP_000510 |
USD 400.00 |
|
VC100014 | Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus 1], codon optimized for human cell expression, AP_000511 |
USD 400.00 |
|
VC100015 | Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus 1], codon optimized for human cell expression, AP_000512 |
USD 1,530.00 |
|
VC100016 | Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus 1], codon optimized for human cell expression, AP_000513 |
USD 400.00 |
|
VC100017 | Myc-DDK-tagged ORF clone of viral ORF for DBP [Human adenovirus 1], codon optimized for human cell expression, AP_000514 |
USD 670.00 |
|
VC100018 | Myc-DDK-tagged ORF clone of viral ORF for 100K [Human adenovirus 1], codon optimized for human cell expression, AP_000515 |
USD 1,290.00 |
|
VC100019 | Myc-DDK-tagged ORF clone of viral ORF for 33K [Human adenovirus 1], codon optimized for human cell expression, AP_000516 |
USD 400.00 |
|
VC100020 | Myc-DDK-tagged ORF clone of viral ORF for 22K [Human adenovirus 1], codon optimized for human cell expression, AP_000517 |
USD 400.00 |
|
VC100021 | Myc-DDK-tagged ORF clone of viral ORF for pVIII [Human adenovirus 1], codon optimized for human cell expression, AP_000518 |
USD 400.00 |
|
VC100023 | Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-alpha0 [Human adenovirus 1], codon optimized for human cell expression, AP_000520 |
USD 400.00 |
|
VC100024 | Myc-DDK-tagged ORF clone of viral ORF for E3 gp19K [Human adenovirus 1], codon optimized for human cell expression, AP_000521 |
USD 400.00 |
|
VC100025 | Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-beta0 [Human adenovirus 1], codon optimized for human cell expression, AP_000522 |
USD 400.00 |
|
VC100026 | Myc-DDK-tagged ORF clone of viral ORF for E3 RID-alpha [Human adenovirus 1], codon optimized for human cell expression, AP_000523 |
USD 400.00 |
|
VC100027 | Myc-DDK-tagged ORF clone of viral ORF for E3 147K [Human adenovirus 1], codon optimized for human cell expression, AP_000525 |
USD 400.00 |
|
VC100028 | Myc-DDK-tagged ORF clone of viral ORF for E3 RID-beta [Human adenovirus 1], codon optimized for human cell expression, AP_000524 |
USD 400.00 |
|
VC100029 | Myc-DDK-tagged ORF clone of viral ORF for U exon, partial [Human adenovirus 1], codon optimized for human cell expression, AP_000526 |
USD 400.00 |
|
VC100030 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus 1], codon optimized for human cell expression, AP_000527 |
USD 740.00 |
|
VC100031 | Myc-DDK-tagged ORF clone of viral ORF for E4 34K [Human adenovirus 1], codon optimized for human cell expression, AP_000529 |
USD 400.00 |
|
VC100032 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF6/7 [Human adenovirus 1], codon optimized for human cell expression, AP_000528 |
USD 400.00 |
|
VC100033 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF4 [Human adenovirus 1], codon optimized for human cell expression, AP_000530 |
USD 400.00 |
|
VC100034 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF3 [Human adenovirus 1], codon optimized for human cell expression, AP_000531 |
USD 400.00 |
|
VC100035 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF2 [Human adenovirus 1], codon optimized for human cell expression, AP_000532 |
USD 400.00 |
|
VC100036 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF1 [Human adenovirus 1], codon optimized for human cell expression, AP_000533 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review