Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Rat
Applications
- IHC
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- ABCB1 (85)
- CTNNB1 (71)
- AKT1 (64)
- JUN (63)
- NCAM1 (55)
- BCL2 (50)
- PIK3CG (50)
- L1CAM (42)
- GLI1 (38)
- ID3 (36)
- NKX2-1 (34)
- STAT5A (32)
- EGFR (31)
- NEUROG1 (31)
- TNNI3 (31)
- VIM (30)
- GFAP (29)
- MAPK9 (27)
- HES1 (24)
- SMAD1 (24)
- HGF (21)
- GATA3 (20)
- LHX1 (20)
- NOTCH1 (18)
- CDX2 (17)
- FN1 (17)
- MPI (16)
- CDH2 (15)
- DVL2 (15)
- GAPDH (15)
- PDGFRA (15)
- BCL2L1 (14)
- CASP3 (14)
- IRF6 (13)
- MAPK8 (13)
- ID2 (12)
- IGF1 (12)
- PDX1 (12)
- YBX1 (12)
- ITGB3 (11)
- KLF5 (11)
- SOX9 (11)
- TRIM33 (11)
- AKT3 (9)
- FOXA2 (9)
- AKT2 (8)
- ANGPT1 (8)
- BSG (8)
- JAG1 (8)
- SMAD3 (8)
- ACTN1 (7)
- MAPK3 (7)
- NT5E (7)
- PDGFRB (7)
- STAT5B (7)
- BDNF (6)
- ENPEP (6)
- GATA4 (6)
- GCG (6)
- HNF4A (6)
- KDR (6)
- LEF1 (6)
- MAPK6 (6)
- SMURF2 (6)
- SRC (6)
- ACTB (5)
- DLX1 (5)
- NEFL (5)
- ONECUT1 (5)
- PRKCA (5)
- PTCH1 (5)
- TAL1 (5)
- CDH1 (4)
- HCRTR1 (4)
- MAP2 (4)
- SLC2A1 (4)
- SOX2 (4)
- TCF3 (4)
- ALDH1A1 (3)
- ANPEP (3)
- CEBPA (3)
- CSNK1A1 (3)
- CSNK2A1 (3)
- CXCR4 (3)
- CYP3A4 (3)
- HNF1A (3)
- HNF1B (3)
- INS (3)
- ITGAM (3)
- JMJD6 (3)
- LAMA1 (3)
- SERPINA1 (3)
- SHH (3)
- SMAD5 (3)
- TGFB1 (3)
- TNC (3)
- TTR (3)
- ALCAM (2)
- APH1A (2)
- AXIN1 (2)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (656)
- Focal adhesion (517)
- Colorectal cancer (468)
- Prostate cancer (336)
- ErbB signaling pathway (324)
- Neurotrophin signaling pathway (297)
- MAPK signaling pathway (279)
- Endometrial cancer (256)
- Toll-like receptor signaling pathway (241)
- Pancreatic cancer (238)
- Melanoma (235)
- T cell receptor signaling pathway (230)
- Renal cell carcinoma (229)
- Wnt signaling pathway (228)
- Small cell lung cancer (218)
- Apoptosis (210)
- Glioma (210)
- Chronic myeloid leukemia (203)
- B cell receptor signaling pathway (202)
- Jak-STAT signaling pathway (196)
- Progesterone-mediated oocyte maturation (193)
- Acute myeloid leukemia (190)
- Fc epsilon RI signaling pathway (183)
- Insulin signaling pathway (181)
- Tight junction (178)
- Non-small cell lung cancer (176)
- Regulation of actin cytoskeleton (168)
- Leukocyte transendothelial migration (157)
- VEGF signaling pathway (155)
- Epithelial cell signaling in Helicobacter pylori infection (154)
- mTOR signaling pathway (153)
- Adherens junction (152)
- GnRH signaling pathway (152)
- Chemokine signaling pathway (150)
- Basal cell carcinoma (149)
- Fc gamma R-mediated phagocytosis (144)
- Cell adhesion molecules (CAMs) (142)
- Adipocytokine signaling pathway (125)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (118)
- Type II diabetes mellitus (112)
- Melanogenesis (109)
- TGF-beta signaling pathway (108)
- Cytokine-cytokine receptor interaction (107)
- Pathogenic Escherichia coli infection (89)
- Thyroid cancer (88)
- ABC transporters (86)
- Amyotrophic lateral sclerosis (ALS) (83)
- Prion diseases (82)
- Natural killer cell mediated cytotoxicity (81)
- Gap junction (76)
- Endocytosis (74)
- Notch signaling pathway (70)
- Hypertrophic cardiomyopathy (HCM) (66)
- Maturity onset diabetes of the young (66)
- Dilated cardiomyopathy (65)
- Calcium signaling pathway (59)
- Axon guidance (56)
- Dorso-ventral axis formation (56)
- Hedgehog signaling pathway (56)
- Phosphatidylinositol signaling system (55)
- Inositol phosphate metabolism (50)
- Metabolic pathways (50)
- NOD-like receptor signaling pathway (47)
- Bladder cancer (44)
- RIG-I-like receptor signaling pathway (41)
- Alzheimer's disease (39)
- ECM-receptor interaction (39)
- Hematopoietic cell lineage (33)
- Cardiac muscle contraction (31)
- Viral myocarditis (28)
- p53 signaling pathway (27)
- Long-term depression (24)
- Huntington's disease (22)
- Oocyte meiosis (22)
- Amino sugar and nucleotide sugar metabolism (16)
- Fructose and mannose metabolism (16)
- Glycolysis / Gluconeogenesis (15)
- Parkinson's disease (14)
- Cell cycle (13)
- Long-term potentiation (12)
- Vascular smooth muscle contraction (12)
- Renin-angiotensin system (10)
- Type I diabetes mellitus (10)
- Vibrio cholerae infection (10)
- Autoimmune thyroid disease (8)
- Nicotinate and nicotinamide metabolism (8)
- Allograft rejection (7)
- Antigen processing and presentation (7)
- Graft-versus-host disease (7)
- Neuroactive ligand-receptor interaction (7)
- Purine metabolism (7)
- Pyrimidine metabolism (7)
- Systemic lupus erythematosus (7)
- Retinol metabolism (6)
- Ubiquitin mediated proteolysis (6)
- Complement and coagulation cascades (5)
- Drug metabolism - cytochrome P450 (3)
- Drug metabolism - other enzymes (3)
- Glutathione metabolism (3)
- Linoleic acid metabolism (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Regulation of autophagy (3)
- Lysosome (2)
- Primary immunodeficiency (2)
- Tyrosine metabolism (2)
- Cysteine and methionine metabolism (1)
- Oxidative phosphorylation (1)
- Phenylalanine (1)
- Phenylalanine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)