Germany
Japan
United Kingdom
China
USD 390.00
2 Weeks
Integrin alpha 3 (ITGA3) (3B Isoform specific) mouse monoclonal antibody, clone 54B3, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
Primary Antibodies
View as table Download
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Ab-349) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N). |
Rabbit polyclonal anti-NOM1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOM1. |
Rabbit polyclonal CACNA2D2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2. |
Rabbit polyclonal CTNA1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CTNA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 30-59 amino acids from the N-terminal region of human CTNA1. |
Rabbit Polyclonal Anti-ACTN3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY |
Rabbit anti Dystrophin Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the intra domain 410-450aa of human Dystrophin protein. This sequence is identical to mouse and Pan troglodytes and other species. |
CDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Human |
gamma Catenin (JUP) mouse monoclonal antibody, clone CN-3, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Rat |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Rat |
CD61 (ITGB3) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 741-790 of Human Integrin β3. |
Integrin alpha 1 (ITGA1) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 727-755 amino acids from the Central region of human ITGA1. |
Lamin A (N-Terminus) rabbit polyclonal antibody, Affinity purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide made from the last 8 amino acids of Lamin C, including an N-Terminus lysine as a linker (KHHVSGSRR), coupled to KLH |
Integrin alpha 6 (ITGA6) (1043-1072) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from isoform 2 of human ITGA6. |
gamma Catenin (JUP) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human Cateninγ |
Lamin A (LMNA) mouse monoclonal antibody, clone X67, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Human, Xenopus |
USD 390.00
2 Weeks
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit polyclonal Shc (Tyr349) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine349 (H-Q-YP-Y-N) |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Filter by
Target Symbol
- CTNNB1 (83)
- DES (30)
- ITGB3 (21)
- JUP (21)
- CDH2 (16)
- SHC1 (16)
- LMNA (10)
- ACTB (9)
- ACTN1 (9)
- GJA1 (9)
- ITGA6 (8)
- DSP (7)
- LEF1 (7)
- ACTN2 (6)
- ITGB1 (6)
- ITGA3 (5)
- SGCD (5)
- ACTN4 (4)
- CACNA1C (4)
- CTNNA1 (4)
- DMD (4)
- DSG2 (4)
- ITGA4 (4)
- ITGB4 (4)
- ACTN3 (3)
- ITGA2 (3)
- ITGA2B (3)
- ACTG1 (2)
- CACNA2D2 (2)
- CACNB1 (2)
- DSC2 (2)
- EMD (2)
- ITGA5 (2)
- ITGA7 (2)
- ITGAV (2)
- RYR2 (2)
- TCF7 (2)
- ATP2A2 (1)
- CACNA1D (1)
- CACNA1S (1)
- CACNB2 (1)
- CACNG5 (1)
- CACNG6 (1)
- CACNG8 (1)
- ITGA1 (1)
- ITGA11 (1)
- ITGA8 (1)
- ITGB5 (1)
- ITGB6 (1)
- ITGB7 (1)
- LAMA2 (1)
- PKP2 (1)
- SGCA (1)
- SGCB (1)
- TCF7L1 (1)
Reactivities
- Human (251)
- Mouse (225)
- Rat (204)
- Monkey (51)
- Dog (49)
- Bovine (10)
- Chicken (6)
- Horse (5)
- Bat (3)
- Pig (3)
- Rabbit (3)
- Xenopus (3)
- Chimpanzee (2)
- Hamster (2)
- Rhesus Monkey (2)
- All Species (1)
- Avian (1)
- Cow (1)
- Feline (1)
- Gorilla (1)
- Guinea Pig (1)
- Porcine (1)
- Primate (1)
- Sheep (1)
- X. tropicalis (1)
- Zebrafish (1)