Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TRPP1 (PKD2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)ERWESDDAASQISH, corresponding to amino acid residues 914-927 of human TRPP1. Intracellular, C-terminus.

Rabbit Polyclonal Vanilloid R1/TRPV1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the rat TRPV1 protein (between residues 1-50) [UniProt O35433]

Rabbit Polyclonal TRPC6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6.

Rabbit Polyclonal Anti-TRPA1 (extracellular)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NSTGIINETSDHSE, corresponding to amino acid residues 747-760 of human TRPA1. 1st extracellular loop.

Rabbit Polyclonal Anti-Alpha-tubulin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Alpha-tubulin antibody was raised against an 18 amino acid peptide near the amino terminus of human alpha-tubulin

Rabbit Polyclonal Anti-TRPM7

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CKRRKKDKTSDGPKLFLTEE, corresponding to amino acid residues 1146-1165 of human TRPM7. Intracellular, C-terminus.

Rabbit Polyclonal Anti-TRPC1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular.

Rabbit Polyclonal Antibody against TRPM8 (Center R536)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 521-552 amino acids from the Central region of human TRPM8.

Rabbit Polyclonal TRPM8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TRPM8 protein (between residues 250-300) [UniProt Q7Z2W7]

Rabbit Polyclonal TRPC6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRPC6 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC6.

Mouse Monoclonal anti-trpm7 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRPV2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Horse, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%).

Rabbit Polyclonal Anti-TRPC3 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC3 antibody: synthetic peptide directed towards the n terminal of human TRPC3. Synthetic peptide located within the following region: MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG

Mouse Monoclonal anti-TRPC5 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal TRPA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus (residues 1-100) of the human TRPA1 protein. [Swiss-Prot# O75762]

Rabbit polyclonal Anti-MCOLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: ENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNK

Rabbit Polyclonal Anti-TRPA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL

Rabbit Polyclonal TRPC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRPC3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC3.

TRPC5 Mouse Monoclonal (S67-15) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse monoclonal anti-TRPC6 antibody

Applications IHC, WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated

Anti-TRPC3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3

Rabbit Polyclonal Anti-TRPM8 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide SDVDGTTYDFAHC, corresponding to amino acid residues 917-929 of human TRPM8. 3rd extracellular loop.

Rabbit Polyclonal Anti-MCOLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI

Rabbit Polyclonal TRPC3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRPC3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC3.

Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759)

Rabbit Polyclonal Mucolipin 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the mouse protein (within residues 500-580). [Swiss-Prot# Q99J21]

TRPV3 Mouse anti-Rat Monoclonal (aa458-474) (S15-39) Antibody

Applications IHC
Reactivities Human, Mouse, Rat

Rabbit Polyclonal TRPV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Rabbit polyclonal TRPV1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human TRPV1.

Rabbit Polyclonal TRPV4 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRPV4 antibody was raised against an 18 amino acid peptide near the center of human TRPV4. The immunogen is located within amino acids 380 - 430 of TRPV4.

Rabbit Polyclonal Anti-TRPM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK

Rabbit Polyclonal Anti-TRPC6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the N terminal of human TRPC6. Synthetic peptide located within the following region: MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC

Rabbit Polyclonal Anti-TRPC3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRPC3 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TRPC3.

VRL1 (TRPV2) (595-764) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 595 and 764 of VRL1

TRP 7 (TRPC7) goat polyclonal antibody, Aff - Purified

Applications ELISA, IP, WB
Reactivities Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_065122.1; NP_001161049.1; NP_001161048.1.

Rabbit Polyclonal Antibody against TRPM8 (C-term C940)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 926-956 amino acids from the C-terminal region of human TRPM8.

Goat Polyclonal Antibody against TRPV5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SHRGWEILRQNT, from the internal region of the protein sequence according to NP_062815.2.

Mouse Monoclonal anti-trpc4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal TRPM8 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the Central region of human TRPM8.

Rabbit polyclonal TRPC5 Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPC5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-283 amino acids from the N-terminal region of human TRPC5.

Rabbit Polyclonal Anti-TRPV6

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NRGLEDGESWEYQI, corresponding to amino acid residues 712-725 of human TRPV6.Intracellular, C-terminus.

Rabbit Polyclonal Anti-TRPV3 (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)REEEAIPHPLALTHK, corresponding to amino acid residues 464-478 of human TRPV3. 1st extracellular loop.

Rabbit Polyclonal Anti-TRPV5

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)GLNLSEGDGEEVYHF, corresponding to amino acid residues 715-729 of human TRPV5. Intracellular, C-terminus.

Rabbit polyclonal Anti-TRPV5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Rabbit Polyclonal Anti-TRPM8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP

Rabbit Polyclonal TRPV6 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

TRPM8 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 76-106 amino acids from the N-terminal region of human TRPM8

Rabbit Polyclonal Antibody against TRPM8 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1075-1104 amino acids from the C-terminal region of human TRPM8.

Goat Polyclonal Antibody against TRPM7

Applications WB
Reactivities Mouse, Rat, CrayFish
Conjugation Unconjugated
Immunogen Peptide with sequence C-TKESESTNSVRLML, from the C Terminus of the protein sequence according to NP_060142.2.

Goat Anti-TRPC4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KHAKEEDSSIDYD, from the internal region (near C-Terminus) of the protein sequence according to NP_057263.1.

Goat Anti-Polycystin 2 / PKD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ERAKLKRREVLGR, from the internal region of the protein sequence according to NP_000288.1.