Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit monoclonal anti-PARK7 antibody for SISCAPA, clone OTIR4F10
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against CASP3 (Clone E87)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal SDHD Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SDHD antibody was raised against a 15 amino acid synthetic peptide near the center of human SDHD. |
Rabbit anti-CYCS Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYCS |
VDAC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human VDAC1 |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CASP3 |
Rabbit anti-NDUFS1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NDUFS1 |
Rabbit Polyclonal Anti-LRRK2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LRRK2 |
Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796) |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CASP3 |
Rabbit Polyclonal Anti-SDHB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
Rabbit Polyclonal Anti-SNRPN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SNRPN antibody was raised against a 20 amino acid peptide near the amino terminus of human SNRPN. |
Rabbit Polyclonal Anti-PDCL3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PDCL3 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human PDCL3. |
Goat Polyclonal Anti-NDUFA7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Rabbit polyclonal APAF-1-ALT antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human APAF-1-ALT. |
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Rabbit polyclonal anti-NDUFA4L2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit polyclonal Parkin Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 387-417 amino acids from the C-terminal region of human Parkin. |
PARK2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PARK2 |
Rabbit anti-PARK7 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PARK7 |
Rabbit Polyclonal Anti-BSDC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BSDC1 antibody: synthetic peptide directed towards the N terminal of human BSDC1. Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC |
Rabbit Monoclonal Antibody against CASP3 (Clone E83-103)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against PPID / CyP-40
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1. |
Rabbit polyclonal antibody to UBE2G2 (ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast))
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 165 of UBE2G2 (Uniprot ID#P60604) |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ATP5F1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP5F1 antibody: synthetic peptide directed towards the middle region of human ATP5F1. Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST |
Rabbit Polyclonal Anti-NDUFV1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDUFV1 antibody: synthetic peptide directed towards the N terminal of human NDUFV1. Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG |
Rabbit polyclonal anti-COX IV antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit monoclonal antibody against Ubiquitin (C-term)(EP296YT)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against UBA7(clone EPR4270)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-PINK1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 488 of mouse PINK1 |
Rabbit anti-UCHL1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UCHL1 |
Rabbit anti-SLC25A4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SLC25A4 |
Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985) |
USD 415.00
In Stock
Rabbit Polyclonal antibody to UQCRC1 (ubiquinol-cytochrome c reductase core protein I)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of UQCRC1 (Uniprot ID#P31930) |
Rabbit Polyclonal antibody to SDHB (succinate dehydrogenase complex, subunit B, iron sulfur (Ip))
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 221 and 280 of SDHB (Uniprot ID#P21912) |
Rabbit Polyclonal antibody to UBE2L3 (ubiquitin-conjugating enzyme E2L 3)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 92 and 154 of UBE2L3 (Uniprot ID#P68036) |
Rabbit polyclonal anti-ATP5A1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5A1. |
Rabbit polyclonal Parkin Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 111-140 amino acids from the N-terminal region of human Parkin. |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
Modifications | Phospho-specific |
Rabbit Polyclonal Synuclein (Ser129) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Synuclein around the phosphorylation site of Serine 129 |
Modifications | Phospho-specific |
Rabbit polyclonal DJ-1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human DJ-1. |
Rabbit anti-HTRA2 Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HTRA2 |
Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353) |
Rabbit Polyclonal Anti-VDAC2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |