Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit polyclonal antibody to HMGA2 (high mobility group AT-hook 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 109 of HMGA2 (Uniprot ID#P52926) |
Rabbit anti-DBI Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBI |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
AKR1C3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AKR1C3 |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-SPTAN1 Antibody - N-terminal region
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1. Synthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ |
Rabbit Polyclonal Anti-WDR5 Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDR5 antibody: synthetic peptide directed towards the C terminal of human WDR5. Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI |
Rabbit Polyclonal LSD1 Antibody
| Applications | ELISA, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSD1 antibody: human JMJD2a (Jumonji domain containing 2a), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- IP
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Filter by
Target Symbol
- XRCC5 (4)
- CDK1 (2)
- KCNH2 (2)
- AK4 (1)
- AKR1C3 (1)
- APEH (1)
- APTX (1)
- ARRB1 (1)
- BABAM2 (1)
- BAK1 (1)
- BAX (1)
- BCL2 (1)
- BCL2L1 (1)
- BMI1 (1)
- BNIP3L (1)
- BUD23 (1)
- CAV2 (1)
- CCNH (1)
- CD3E (1)
- CDK4 (1)
- CDK5 (1)
- CHUK (1)
- CPT1A (1)
- CTNNA1 (1)
- DBI (1)
- DCTN1 (1)
- DDB1 (1)
- DNMT3A (1)
- EED (1)
- EHMT2 (1)
- ELOB (1)
- ENO1 (1)
- ESRRA (1)
- EZH2 (1)
- FADD (1)
- FANCD2 (1)
- FASN (1)
- FBXO7 (1)
- FKBP4 (1)
- FOS (1)
- G3BP1 (1)
- GDF15 (1)
- GNAS (1)
- H2AFZ (1)
- HADHA (1)
- HDAC1 (1)
- HDAC2 (1)
- HDAC9 (1)
- HIF1AN (1)
- HK1 (1)
- HMGA2 (1)
- HNMT (1)
- HNRNPUL1 (1)
- HUS1 (1)
- IRF3 (1)
- ITGAV (1)
- JUP (1)
- KDM1A (1)
- KIF5C (1)
- KPNA2 (1)
- LBR (1)
- LITAF (1)
- LRRK2 (1)
- MCM3 (1)
- MNAT1 (1)
- MTOR (1)
- NGFR (1)
- NR0B1 (1)
- NR3C1 (1)
- NR4A3 (1)
- NUP62 (1)
- OPTN (1)
- PAX8 (1)
- PCK1 (1)
- PDHA1 (1)
- PDIA6 (1)
- PIM2 (1)
- POLR2C (1)
- PPP4C (1)
- PRKAA2 (1)
- PSEN1 (1)
- PSMA3 (1)
- PSMA4 (1)
- PSMB2 (1)
- PSMC5 (1)
- RAD17 (1)
- RBBP6 (1)
- RFC4 (1)
- RNF2 (1)
- RNF25 (1)
- ROCK1 (1)
- RPA2 (1)
- RPS6KB2 (1)
- RRM1 (1)
- SATB1 (1)
- SERPINH1 (1)
- SET (1)
- SIN3A (1)
- SIRT7 (1)
- SMC1A (1)
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (17)
- Metabolic pathways (11)
- Cell cycle (9)
- Adipocytokine signaling pathway (6)
- Apoptosis (6)
- Huntington's disease (6)
- Insulin signaling pathway (6)
- MAPK signaling pathway (6)
- Small cell lung cancer (6)
- Acute myeloid leukemia (5)
- Chronic myeloid leukemia (5)
- Neurotrophin signaling pathway (5)
- Nucleotide excision repair (5)
- T cell receptor signaling pathway (5)
- Toll-like receptor signaling pathway (5)
- Focal adhesion (4)
- Gap junction (4)
- Glycolysis / Gluconeogenesis (4)
- Non-homologous end-joining (4)
- Oocyte meiosis (4)
- Proteasome (4)
- RIG-I-like receptor signaling pathway (4)
- p53 signaling pathway (4)
- Alzheimer's disease (3)
- Amyotrophic lateral sclerosis (ALS) (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Chemokine signaling pathway (3)
- Colorectal cancer (3)
- DNA replication (3)
- Notch signaling pathway (3)
- PPAR signaling pathway (3)
- Pancreatic cancer (3)
- Prostate cancer (3)
- Purine metabolism (3)
- Tight junction (3)
- Ubiquitin mediated proteolysis (3)
- mTOR signaling pathway (3)
- Axon guidance (2)
- B cell receptor signaling pathway (2)
- Butanoate metabolism (2)
- Citrate cycle (TCA cycle) (2)
- Cytosolic DNA-sensing pathway (2)
- Dilated cardiomyopathy (2)
- Endocytosis (2)
- ErbB signaling pathway (2)
- Fatty acid metabolism (2)
- Glioma (2)
- Hematopoietic cell lineage (2)
- Histidine metabolism (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Leukocyte transendothelial migration (2)
- Lysine degradation (2)
- Mismatch repair (2)
- NOD-like receptor signaling pathway (2)
- Neuroactive ligand-receptor interaction (2)
- Non-small cell lung cancer (2)
- Pathogenic Escherichia coli infection (2)
- Primary immunodeficiency (2)
- Progesterone-mediated oocyte maturation (2)
- Pyrimidine metabolism (2)
- Pyruvate metabolism (2)
- Regulation of actin cytoskeleton (2)
- TGF-beta signaling pathway (2)
- Type II diabetes mellitus (2)
- Valine (2)
- Vascular smooth muscle contraction (2)
- Wnt signaling pathway (2)
- Adherens junction (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Androgen and estrogen metabolism (1)
- Arachidonic acid metabolism (1)
- Biosynthesis of unsaturated fatty acids (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Cell adhesion molecules (CAMs) (1)
- Cysteine and methionine metabolism (1)
- Cytokine-cytokine receptor interaction (1)
- ECM-receptor interaction (1)
- Endometrial cancer (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Fatty acid biosynthesis (1)
- Fatty acid elongation in mitochondria (1)
- Fc gamma R-mediated phagocytosis (1)
- Folate biosynthesis (1)
- Fructose and mannose metabolism (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- GnRH signaling pathway (1)
- Homologous recombination (1)
- Jak-STAT signaling pathway (1)
- Limonene and pinene degradation (1)
- Long-term depression (1)
- Melanogenesis (1)
- Melanoma (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Natural killer cell mediated cytotoxicity (1)
- Parkinson's disease (1)
- Prion diseases (1)
- Propanoate metabolism (1)
- RNA degradation (1)
- RNA polymerase (1)
- Regulation of autophagy (1)
- Renal cell carcinoma (1)
- Selenoamino acid metabolism (1)
- Starch and sucrose metabolism (1)
- Systemic lupus erythematosus (1)
- Taste transduction (1)
- Thyroid cancer (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- Vibrio cholerae infection (1)
- beta-Alanine metabolism (1)
- leucine and isoleucine biosynthesis (1)
- leucine and isoleucine degradation (1)