Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit polyclonal antibody to dynactin 1 (dynactin 1 (p150, glued homolog, Drosophila))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1216 and 1278 of DCTN1 (Uniprot ID#Q14203) |
Rabbit anti-TGM2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TGM2 |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
Rabbit anti-SLC25A4 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC25A4 |
Rabbit Polyclonal Anti-PSD95 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSD95 Antibody: A synthesized peptide derived from human PSD95 |
Rabbit Polyclonal Anti-CREB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CREB1 |
Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985) |
Rabbit Polyclonal antibody to SDHB (succinate dehydrogenase complex, subunit B, iron sulfur (Ip))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 221 and 280 of SDHB (Uniprot ID#P21912) |
Rabbit polyclonal anti-ATP5A1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5A1. |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
| Modifications | Phospho-specific |
Rabbit polyclonal POLR2A (Ab-1619) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S). |
Active filters
Category
- Antibodies
Reactivities
- Rat
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Pathways
- Huntington's disease
Filter by
Target Symbol
- CREB1 (19)
- TP53 (15)
- HDAC2 (14)
- BAX (12)
- CASP3 (12)
- HDAC1 (12)
- GRIN1 (11)
- CASP9 (10)
- GRIN2B (10)
- SOD2 (7)
- SP1 (7)
- APAF1 (6)
- CYCS (6)
- PPARG (6)
- PPARGC1A (6)
- COX5B (4)
- DCTN2 (4)
- GRM5 (4)
- NDUFS1 (4)
- BBC3 (3)
- BDNF (3)
- CASP8 (3)
- DCTN1 (3)
- DLG4 (3)
- EP300 (3)
- POLR2G (3)
- SDHA (3)
- SLC25A4 (3)
- SOD1 (3)
- TGM2 (3)
- AP2M1 (2)
- AP2S1 (2)
- ATP5PF (2)
- COX4I1 (2)
- COX4I2 (2)
- COX5A (2)
- COX6B1 (2)
- COX6C (2)
- COX7B (2)
- CREBBP (2)
- DNAI2 (2)
- DNAL1 (2)
- NDUFB9 (2)
- NDUFS6 (2)
- NDUFV2 (2)
- NRF1 (2)
- PLCB3 (2)
- POLR2A (2)
- SDHB (2)
- TBP (2)
- VDAC1 (2)
- VDAC2 (2)
- AP2A2 (1)
- AP2B1 (1)
- ATP5F1A (1)
- ATP5F1B (1)
- ATP5F1D (1)
- ATP5MC3 (1)
- ATP5PD (1)
- CLTA (1)
- CLTC (1)
- COX6A2 (1)
- COX6B2 (1)
- COX7A2 (1)
- COX7B2 (1)
- COX8A (1)
- CREB3L2 (1)
- DCTN4 (1)
- HAP1 (1)
- ITPR1 (1)
- LCMT2 (1)
- NDUFA1 (1)
- NDUFA4 (1)
- NDUFA5 (1)
- NDUFA9 (1)
- NDUFC2 (1)
- NDUFS2 (1)
- NDUFS4 (1)
- NDUFS5 (1)
- PLCB1 (1)
- PLCB2 (1)
- POLR2B (1)
- POLR2D (1)
- POLR2E (1)
- POLR2H (1)
- POLR2I (1)
- SDHD (1)
- SIN3A (1)
- TFAM (1)
- UCP1 (1)
- UQCRC1 (1)
- UQCRC2 (1)
- UQCRFS1 (1)
- VDAC3 (1)
Applications
Clonalities
Modifications
Families
- Druggable Genome (215)
- Transcription Factors (104)
- Stem cell - Pluripotency (58)
- Transmembrane (56)
- Protease (27)
- ES Cell Differentiation/IPS (22)
- Ion Channels: Glutamate Receptors (21)
- Adult stem cells (15)
- Stem cell relevant signaling - DSL/Notch pathway (12)
- Stem cell relevant signaling - JAK/STAT signaling pathway (7)
- Nuclear Hormone Receptor (6)
- Ion Channels: Other (5)
- GPCR (4)
- Embryonic stem cells (3)
- Induced pluripotent stem cells (3)
- Secreted Protein (3)