Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit polyclonal MCM3 (Thr722) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MCM3 around the phosphorylation site of threonine 722. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BUB3 Antibody - N-terminal region
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3. Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal antibody to Mad2L1 (MAD2 mitotic arrest deficient-like 1 (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 205 of MAD2L1 (Uniprot ID#Q13257) |
Rabbit Polyclonal p21 Cip1 (Thr145) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p21 Cip1 around the phosphorylation site of Threonine 145 |
| Modifications | Phospho-specific |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit polyclonal anti-APC10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit polyclonal anti-PCNA antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCNA |
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Active filters
Reactivities
- Human
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Cell cycle
Filter by
Category
Target Symbol
- TP53 (36)
- SMAD3 (20)
- CDC25A (19)
- CHEK1 (19)
- HDAC2 (18)
- CCNB1 (16)
- CDK1 (16)
- GSK3B (16)
- SMAD2 (16)
- CDKN2A (15)
- CHEK2 (15)
- MYC (15)
- HDAC1 (14)
- RB1 (13)
- ABL1 (12)
- CCNE1 (12)
- MDM2 (11)
- CDK2 (10)
- CCNA1 (9)
- CCND1 (9)
- YWHAB (9)
- CDC25B (8)
- CDC25C (8)
- CDK7 (8)
- CDKN1A (8)
- E2F1 (8)
- PCNA (8)
- PRKDC (8)
- SMAD4 (8)
- TFDP1 (8)
- TGFB2 (8)
- ANAPC1 (7)
- CCND3 (7)
- CCNH (7)
- CDC16 (7)
- CDKN1B (7)
- E2F2 (7)
- MAD2L1 (7)
- MCM3 (7)
- SMC1A (7)
- TGFB1 (7)
- YWHAE (7)
- BUB1 (6)
- CCNA2 (6)
- CDC23 (6)
- CDC27 (6)
- CDK6 (6)
- CDKN2C (6)
- EP300 (6)
- PLK1 (6)
- SFN (6)
- ANAPC10 (5)
- ATM (5)
- CCNB2 (5)
- CCND2 (5)
- CCNE2 (5)
- CDC20 (5)
- CDKN1C (5)
- CDKN2B (5)
- CREBBP (5)
- CUL1 (5)
- MCM2 (5)
- YWHAQ (5)
- ATR (4)
- BUB3 (4)
- CDC2 (4)
- CDC7 (4)
- CDK4 (4)
- E2F4 (4)
- PTTG1 (4)
- RBL2 (4)
- TGFB3 (4)
- TTK (4)
- ANAPC5 (3)
- BUB1B (3)
- CCNB3 (3)
- DCLRE1C (3)
- GADD45A (3)
- MAD1L1 (3)
- PKMYT1 (3)
- SKP1 (3)
- SKP2 (3)
- TFDP2 (3)
- YWHAG (3)
- ANAPC4 (2)
- ANAPC7 (2)
- CDC14A (2)
- CDC45 (2)
- CDKN2D (2)
- DBF4 (2)
- E2F3 (2)
- E2F5 (2)
- ESPL1 (2)
- GADD45B (2)
- ORC6 (2)
- PTTG2 (2)
- RBL1 (2)
- SMC3 (2)
- WEE1 (2)
- YWHAH (2)