Rabbit Polyclonal AP3B2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | AP3B2 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human AP3B2. The immunogen is located within the first 50 amino acids of AP3B2. |
Rabbit polyclonal GALNS Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GALNS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-263 amino acids from the Central region of human GALNS. |
Rabbit polyclonal LAMP1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This LAMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 125-154 amino acids from the N-terminal region of human LAMP1. |
Rabbit anti-CTSH Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTSH |
Rabbit anti-TPP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TPP1 |
Rabbit anti-HEXA Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HEXA |
Rabbit Polyclonal Anti-GAA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL |
Rabbit Polyclonal Anti-ASAH1 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASAH1 antibody: synthetic peptide directed towards the middle region of human ASAH1. Synthetic peptide located within the following region: QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP |
Rabbit Polyclonal Anti-ACP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP5 antibody: synthetic peptide directed towards the N terminal of human ACP5. Synthetic peptide located within the following region: DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ |
Rabbit Polyclonal Anti-LAMP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMP3 antibody: synthetic peptide directed towards the N terminal of human LAMP3. Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT |
Rabbit Polyclonal Anti-SGSH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the C-terminal region of Human SGSH. Synthetic peptide located within the following region: ARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAP |
Rabbit Polyclonal Anti-Cathepsin G Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G |
Cathepsin K (CTSK) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Bovine, Human, Monkey, Porcine, Rabbit |
| Immunogen | KLH conjugated synthetic peptide between aa 207-27 from the Center region of human CTSK. |
Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 44 and 230 of SGSH (Uniprot ID#P51688) |
Rabbit polyclonal antibody to MANBA (mannosidase, beta A, lysosomal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 380 and 654 of MANBA (Uniprot ID#O00462) |
Rabbit polyclonal antibody to V-ATPase 116 kDa isoform a4 (ATPase, H+ transporting, lysosomal V0 subunit a4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 53 and 295 of V-ATPase 116 kDa isoform a4 (Uniprot ID#Q9HBG4) |
Rabbit polyclonal Cathepsin D (light chain, Cleaved-Gly65) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Cathepsin D AND light chain. |
Rabbit polyclonal Cathepsin D (heavy chain, Cleaved-Leu169) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATD. |
Rabbit polyclonal anti-Cathepsin D antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CTSD. |
Rabbit polyclonal CATL1 (heavy chain, Cleaved-Thr288) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATL1. |
Rabbit polyclonal CATL2 (Cleaved-Leu114) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATL2. |
Rabbit polyclonal CATZ (Cleaved-Leu62) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATZ. |
Rabbit Polyclonal Anti-SLC11A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC11A1 Antibody: synthetic peptide directed towards the C terminal of human SLC11A1. Synthetic peptide located within the following region: VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT |
Rabbit Polyclonal Anti-Ctns Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Ctns Antibody is: synthetic peptide directed towards the middle region of Mouse Ctns. Synthetic peptide located within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP |
Rabbit Polyclonal Anti-GLA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF |
Rabbit Polyclonal Anti-GNPTAB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNPTAB antibody: synthetic peptide directed towards the N terminal of human GNPTAB. Synthetic peptide located within the following region: FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG |
Rabbit Polyclonal Anti-GM2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS |
Rabbit Polyclonal Anti-HYAL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: TIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPD |
Rabbit Polyclonal Anti-Atp6v0a1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH |
IGF2R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
Germany
Japan
United Kingdom
China
