Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal LSD1 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSD1 antibody: human LSD1 (Lysine-specific demethylase 1), using a KLH-conjugated synthetic peptide from the inner part of the protein. |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 17 amino acid peptide near the amino terminus of human PPARGC1A. The immunogen is located within amino acids 200 - 250 of PPARGC1A. |
Active filters
Category
- Antibodies
Applications
- IF
Clonalities
- Polyclonal
Families
- Druggable Genome
Filter by
Target Symbol
- COL1A1 (13)
- RPS6KB1 (13)
- AKT1 (11)
- IRS1 (11)
- SNCA (11)
- CANX (9)
- LTF (9)
- TH (9)
- CASP9 (8)
- FOXO1 (8)
- GJA1 (8)
- HSPD1 (8)
- MYC (8)
- TP53 (8)
- BAX (7)
- CTNNB1 (7)
- KDR (7)
- MAPK8 (7)
- MAPT (7)
- APP (6)
- CCNB1 (6)
- HSP90AB1 (6)
- KDM1A (6)
- MDH1 (6)
- PAK1 (6)
- RXFP1 (6)
- STAT3 (6)
- TAC1 (6)
- UCHL1 (6)
- AKT2 (5)
- ANP32A (5)
- BCL2L11 (5)
- BIRC5 (5)
- BMX (5)
- C3 (5)
- CFL1 (5)
- CFLAR (5)
- COL5A1 (5)
- CX3CR1 (5)
- CXCR4 (5)
- FASN (5)
- GRIA1 (5)
- GRIN2B (5)
- HDAC1 (5)
- HDAC6 (5)
- HSPA5 (5)
- IKBKB (5)
- IKBKG (5)
- IRAK2 (5)
- IRF3 (5)
- LIMK2 (5)
- MET (5)
- NTRK1 (5)
- PDGFRB (5)
- PDIA3 (5)
- PKM (5)
- PTK2 (5)
- PXN (5)
- RACGAP1 (5)
- RPS6KA1 (5)
- SCARB1 (5)
- SQSTM1 (5)
- TLR3 (5)
- ABL1 (4)
- ACE2 (4)
- ACHE (4)
- AIFM1 (4)
- ATG5 (4)
- BBC3 (4)
- BCL2 (4)
- BECN1 (4)
- BMI1 (4)
- BNIP3L (4)
- BRCA1 (4)
- CALR (4)
- CASP8 (4)
- CDKN2A (4)
- CHGA (4)
- CSF1R (4)
- CSNK1A1 (4)
- EGFR (4)
- ENO1 (4)
- ERBB2 (4)
- ERBB3 (4)
- ESR1 (4)
- FANCC (4)
- FLT3 (4)
- FOXO3 (4)
- GSTP1 (4)
- H2AFX (4)
- HDAC2 (4)
- HGS (4)
- HNRNPD (4)
- HTR4 (4)
- HTR5A (4)
- ITGA4 (4)
- ITGAM (4)
- MAP3K5 (4)
- MARCKS (4)
- MDM2 (4)
Reactivities
- Human (2240)
- Mouse (1508)
- Rat (1085)
- Bovine (199)
- Pig (81)
- Monkey (80)
- Chicken (72)
- Rhesus Monkey (57)
- Xenopus (49)
- Canine (45)
- Dog (42)
- X. tropicalis (30)
- Zebrafish (30)
- Hamster (28)
- Rabbit (26)
- Primate (25)
- Chimpanzee (23)
- Porcine (22)
- Sheep (17)
- Cow (13)
- Feline (10)
- Mammalian (10)
- Guinea Pig (9)
- Drosophila (8)
- Avian (2)
- C. elegans (2)
- Fish (2)
- Goat (2)
- Coral (1)
- Equine (1)
- Fungus (1)
- Horse (1)
- Medaka fish (1)
- Mink (1)
- Mustelid (1)
- Quail (1)
Antibody Hosts
Isotypes
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (397)
- Metabolic pathways (206)
- Neuroactive ligand-receptor interaction (201)
- Focal adhesion (200)
- MAPK signaling pathway (190)
- Neurotrophin signaling pathway (177)
- Prostate cancer (165)
- Cytokine-cytokine receptor interaction (158)
- Colorectal cancer (153)
- Chemokine signaling pathway (146)
- Apoptosis (145)
- Small cell lung cancer (142)
- Insulin signaling pathway (138)
- ErbB signaling pathway (132)
- Toll-like receptor signaling pathway (132)
- Chronic myeloid leukemia (130)
- Cell cycle (127)
- Regulation of actin cytoskeleton (125)
- Pancreatic cancer (123)
- Adipocytokine signaling pathway (115)
- T cell receptor signaling pathway (115)
- Calcium signaling pathway (113)
- Wnt signaling pathway (104)
- Acute myeloid leukemia (102)
- Endometrial cancer (99)
- Progesterone-mediated oocyte maturation (99)
- Glioma (95)
- Endocytosis (94)
- Melanoma (94)
- Non-small cell lung cancer (92)
- Jak-STAT signaling pathway (91)
- NOD-like receptor signaling pathway (88)
- p53 signaling pathway (87)
- Amyotrophic lateral sclerosis (ALS) (85)
- Alzheimer's disease (84)
- Leukocyte transendothelial migration (84)
- VEGF signaling pathway (84)
- Huntington's disease (82)
- Axon guidance (81)
- Fc gamma R-mediated phagocytosis (81)
- B cell receptor signaling pathway (80)
- Oocyte meiosis (80)
- Renal cell carcinoma (78)
- Natural killer cell mediated cytotoxicity (75)
- Epithelial cell signaling in Helicobacter pylori infection (74)
- Gap junction (74)
- RIG-I-like receptor signaling pathway (74)
- Adherens junction (69)
- Bladder cancer (69)
- Melanogenesis (68)
- mTOR signaling pathway (67)
- TGF-beta signaling pathway (63)
- Fc epsilon RI signaling pathway (60)
- GnRH signaling pathway (56)
- Type II diabetes mellitus (56)
- Tight junction (55)
- ECM-receptor interaction (54)
- Parkinson's disease (54)
- Ubiquitin mediated proteolysis (53)
- Long-term potentiation (52)
- Vascular smooth muscle contraction (52)
- Thyroid cancer (50)
- Hematopoietic cell lineage (49)
- Basal cell carcinoma (46)
- Pathogenic Escherichia coli infection (46)
- Antigen processing and presentation (42)
- Cytosolic DNA-sensing pathway (41)
- Long-term depression (39)
- Cell adhesion molecules (CAMs) (37)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (36)
- Viral myocarditis (36)
- Olfactory transduction (32)
- Glycolysis / Gluconeogenesis (31)
- Complement and coagulation cascades (30)
- Systemic lupus erythematosus (30)
- Notch signaling pathway (29)
- Purine metabolism (29)
- Hypertrophic cardiomyopathy (HCM) (28)
- Dilated cardiomyopathy (27)
- Primary immunodeficiency (26)
- Prion diseases (26)
- Regulation of autophagy (26)
- Phosphatidylinositol signaling system (25)
- Hedgehog signaling pathway (24)
- Base excision repair (23)
- Lysosome (23)
- Metabolism of xenobiotics by cytochrome P450 (23)
- PPAR signaling pathway (22)
- Pyruvate metabolism (21)
- Type I diabetes mellitus (21)
- Vibrio cholerae infection (20)
- Arginine and proline metabolism (19)
- Arachidonic acid metabolism (18)
- Drug metabolism - cytochrome P450 (17)
- Homologous recombination (17)
- Retinol metabolism (17)
- Tyrosine metabolism (17)
- Inositol phosphate metabolism (16)
- Citrate cycle (TCA cycle) (15)
- Glycerolipid metabolism (15)
- Non-homologous end-joining (15)
- Glycerophospholipid metabolism (14)
- Mismatch repair (14)
- Nucleotide excision repair (14)
- Glutathione metabolism (13)
- Valine (13)
- Butanoate metabolism (12)
- RNA degradation (12)
- DNA replication (11)
- Dorso-ventral axis formation (11)
- Fatty acid metabolism (11)
- Maturity onset diabetes of the young (11)
- Cysteine and methionine metabolism (10)
- Renin-angiotensin system (10)
- Drug metabolism - other enzymes (9)
- Propanoate metabolism (9)
- Tryptophan metabolism (9)
- beta-Alanine metabolism (9)
- Histidine metabolism (8)
- Linoleic acid metabolism (8)
- Primary bile acid biosynthesis (8)
- Pyrimidine metabolism (8)
- leucine and isoleucine degradation (8)
- Alanine (7)
- Allograft rejection (7)
- Fructose and mannose metabolism (7)
- Glyoxylate and dicarboxylate metabolism (7)
- Lysine degradation (7)
- Taste transduction (7)
- aspartate and glutamate metabolism (7)
- Cardiac muscle contraction (6)
- Folate biosynthesis (6)
- Graft-versus-host disease (6)
- Nitrogen metabolism (6)
- Pentose phosphate pathway (6)
- Androgen and estrogen metabolism (5)
- Asthma (5)
- C21-Steroid hormone metabolism (5)
- Fatty acid biosynthesis (5)
- Oxidative phosphorylation (5)
- Porphyrin and chlorophyll metabolism (5)
- Proteasome (5)
- leucine and isoleucine biosynthesis (5)
- ABC transporters (4)
- Aminoacyl-tRNA biosynthesis (4)
- Autoimmune thyroid disease (4)
- Circadian rhythm - mammal (4)
- Galactose metabolism (4)
- Taurine and hypotaurine metabolism (4)
- Terpenoid backbone biosynthesis (4)
- Amino sugar and nucleotide sugar metabolism (3)
- Ascorbate and aldarate metabolism (3)
- Basal transcription factors (3)
- Caffeine metabolism (3)
- Glycine (3)
- Glycosaminoglycan degradation (3)
- Limonene and pinene degradation (3)
- N-Glycan biosynthesis (3)
- Riboflavin metabolism (3)
- Ribosome (3)
- Selenoamino acid metabolism (3)
- Spliceosome (3)
- serine and threonine metabolism (3)
- Heparan sulfate biosynthesis (2)
- SNARE interactions in vesicular transport (2)
- Sphingolipid metabolism (2)
- Starch and sucrose metabolism (2)
- Synthesis and degradation of ketone bodies (2)
- Biosynthesis of unsaturated fatty acids (1)
- Chondroitin sulfate biosynthesis (1)
- D-Glutamine and D-glutamate metabolism (1)
- Methane metabolism (1)
- Nicotinate and nicotinamide metabolism (1)
- O-Glycan biosynthesis (1)
- Other glycan degradation (1)
- Pantothenate and CoA biosynthesis (1)
- Pentose and glucuronate interconversions (1)
- Phenylalanine metabolism (1)
- Sulfur metabolism (1)