Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
USD 479.00
2 Weeks
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Active filters
Category
- Antibodies
Applications
- IF
Conjugates
- Unconjugated
Families
- Druggable Genome
Filter by
Target Symbol
- MAP2K1 (120)
- PDCD1 (89)
- CTAG1B (81)
- MAP2K3 (78)
- TP53 (66)
- LIPG (65)
- KLK8 (64)
- ERCC1 (60)
- ERBB2 (54)
- CDKN2A (52)
- L1CAM (51)
- MAPK13 (51)
- PNMT (48)
- MDM4 (45)
- PECAM1 (42)
- APP (40)
- CD163 (39)
- IDO1 (39)
- LOX (39)
- SQSTM1 (38)
- BSG (36)
- PTPRE (36)
- CTNNB1 (35)
- NPR3 (35)
- AKT1 (34)
- BUB1B (34)
- PSMC3 (34)
- SENP2 (34)
- ACAT2 (33)
- CHGA (33)
- MAPK7 (33)
- MCL1 (33)
- NME4 (33)
- PDE4A (33)
- BTK (32)
- CDK2 (32)
- TH (32)
- CD80 (31)
- ERG (31)
- UBE2G2 (31)
- ALDH1L1 (30)
- BECN1 (30)
- BTN1A1 (30)
- ERCC4 (30)
- LIMK1 (30)
- MAPRE2 (30)
- MMP13 (30)
- PIK3AP1 (30)
- CD19 (28)
- PGAM2 (28)
- CD1C (27)
- PIK3R5 (27)
- SNAP25 (27)
- SNX9 (27)
- SOCS3 (27)
- TAL1 (27)
- LGR5 (26)
- AFP (25)
- CYP1A2 (25)
- RASSF1 (25)
- SIVA1 (25)
- ATP5F1B (24)
- DTYMK (24)
- HDAC6 (24)
- IL1A (24)
- POR (24)
- PRKAR2A (24)
- PRKCE (24)
- RFXANK (24)
- TOMM34 (24)
- TUBAL3 (24)
- UNG (24)
- PGR (23)
- AK4 (22)
- BID (22)
- HRAS (22)
- NKX2-1 (22)
- PPARA (22)
- STAT5A (22)
- TUBB2B (22)
- BRAF (21)
- CD33 (21)
- CPA1 (21)
- EFNA2 (21)
- ID3 (21)
- KCNJ3 (21)
- KHK (21)
- LDLRAP1 (21)
- MUC1 (21)
- PPP5C (21)
- PRKY (21)
- PRMT2 (21)
- PSMD2 (21)
- RAB30 (21)
- RARRES1 (21)
- SIRT5 (21)
- TBXAS1 (21)
- IRF3 (20)
- RPA2 (20)
- SATB1 (20)
Reactivities
- Human (8697)
- Mouse (5676)
- Rat (5125)
- Monkey (1133)
- Dog (1007)
- Bovine (215)
- Pig (82)
- Chicken (78)
- Rhesus Monkey (57)
- Xenopus (53)
- Canine (48)
- Primate (40)
- Hamster (36)
- Rabbit (34)
- Zebrafish (33)
- Porcine (31)
- X. tropicalis (30)
- Chimpanzee (23)
- Sheep (20)
- Cow (14)
- Mammalian (13)
- Drosophila (11)
- Feline (10)
- Guinea Pig (9)
- Goat (4)
- Avian (3)
- Fish (3)
- C. elegans (2)
- Equine (2)
- Chlamydomonas (1)
- Coral (1)
- Fungus (1)
- Horse (1)
- Medaka fish (1)
- Mink (1)
- Mustelid (1)
- Quail (1)
- Yeast (1)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Pathways in cancer (1093)
- Metabolic pathways (1085)
- MAPK signaling pathway (755)
- Neurotrophin signaling pathway (606)
- Prostate cancer (604)
- Focal adhesion (585)
- Toll-like receptor signaling pathway (573)
- T cell receptor signaling pathway (540)
- Chronic myeloid leukemia (539)
- Pancreatic cancer (536)
- Progesterone-mediated oocyte maturation (535)
- Colorectal cancer (531)
- Non-small cell lung cancer (519)
- Fc epsilon RI signaling pathway (504)
- Endometrial cancer (502)
- Insulin signaling pathway (501)
- ErbB signaling pathway (498)
- Melanoma (477)
- Glioma (474)
- Bladder cancer (462)
- Regulation of actin cytoskeleton (453)
- GnRH signaling pathway (422)
- B cell receptor signaling pathway (418)
- Chemokine signaling pathway (398)
- Acute myeloid leukemia (390)
- Renal cell carcinoma (381)
- Gap junction (378)
- Apoptosis (371)
- Cell cycle (371)
- VEGF signaling pathway (357)
- Fc gamma R-mediated phagocytosis (347)
- Cell adhesion molecules (CAMs) (340)
- Natural killer cell mediated cytotoxicity (329)
- Thyroid cancer (328)
- Oocyte meiosis (302)
- Small cell lung cancer (301)
- Leukocyte transendothelial migration (298)
- p53 signaling pathway (292)
- Amyotrophic lateral sclerosis (ALS) (287)
- Jak-STAT signaling pathway (284)
- Wnt signaling pathway (248)
- Melanogenesis (247)
- Cytokine-cytokine receptor interaction (245)
- Purine metabolism (235)
- Vascular smooth muscle contraction (230)
- Adherens junction (228)
- Hematopoietic cell lineage (225)
- Axon guidance (212)
- Adipocytokine signaling pathway (209)
- Long-term potentiation (209)
- Long-term depression (205)
- Prion diseases (200)
- Type II diabetes mellitus (195)
- Neuroactive ligand-receptor interaction (190)
- Epithelial cell signaling in Helicobacter pylori infection (184)
- Huntington's disease (182)
- Alzheimer's disease (181)
- Calcium signaling pathway (179)
- Endocytosis (179)
- Pathogenic Escherichia coli infection (179)
- NOD-like receptor signaling pathway (177)
- Tight junction (175)
- mTOR signaling pathway (173)
- Glycolysis / Gluconeogenesis (159)
- Dorso-ventral axis formation (156)
- Primary immunodeficiency (155)
- Ubiquitin mediated proteolysis (155)
- RIG-I-like receptor signaling pathway (154)
- Basal cell carcinoma (153)
- Nucleotide excision repair (132)
- Parkinson's disease (132)
- Pyrimidine metabolism (131)
- TGF-beta signaling pathway (128)
- Glycerolipid metabolism (121)
- Tryptophan metabolism (114)
- Tyrosine metabolism (107)
- Valine (105)
- Viral myocarditis (96)
- leucine and isoleucine degradation (94)
- Type I diabetes mellitus (93)
- Pyruvate metabolism (91)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (89)
- Antigen processing and presentation (86)
- PPAR signaling pathway (82)
- Drug metabolism - cytochrome P450 (80)
- Graft-versus-host disease (80)
- Proteasome (80)
- Butanoate metabolism (78)
- Metabolism of xenobiotics by cytochrome P450 (78)
- Phosphatidylinositol signaling system (76)
- Arachidonic acid metabolism (75)
- Retinol metabolism (70)
- Base excision repair (69)
- Fructose and mannose metabolism (66)
- Cytosolic DNA-sensing pathway (65)
- Systemic lupus erythematosus (64)
- Hypertrophic cardiomyopathy (HCM) (62)
- Fatty acid metabolism (61)
- Propanoate metabolism (59)
- Dilated cardiomyopathy (57)
- Notch signaling pathway (57)
- Linoleic acid metabolism (56)
- Lysosome (56)
- Complement and coagulation cascades (53)
- Maturity onset diabetes of the young (53)
- Vibrio cholerae infection (51)
- Allograft rejection (48)
- Mismatch repair (48)
- Regulation of autophagy (48)
- Citrate cycle (TCA cycle) (47)
- ECM-receptor interaction (47)
- Hedgehog signaling pathway (47)
- Autoimmune thyroid disease (46)
- Lysine degradation (46)
- Synthesis and degradation of ketone bodies (44)
- Terpenoid backbone biosynthesis (44)
- Inositol phosphate metabolism (41)
- Oxidative phosphorylation (41)
- Pentose phosphate pathway (41)
- DNA replication (40)
- Homologous recombination (40)
- Amino sugar and nucleotide sugar metabolism (38)
- Drug metabolism - other enzymes (36)
- Galactose metabolism (36)
- Olfactory transduction (36)
- Caffeine metabolism (34)
- One carbon pool by folate (33)
- SNARE interactions in vesicular transport (32)
- Starch and sucrose metabolism (31)
- Renin-angiotensin system (28)
- Folate biosynthesis (26)
- Glycine (26)
- serine and threonine metabolism (26)
- Arginine and proline metabolism (25)
- beta-Alanine metabolism (25)
- Alanine (23)
- aspartate and glutamate metabolism (23)
- Glycosaminoglycan degradation (21)
- Primary bile acid biosynthesis (21)
- Glutathione metabolism (20)
- Non-homologous end-joining (20)
- Histidine metabolism (17)
- Sphingolipid metabolism (17)
- Biosynthesis of unsaturated fatty acids (16)
- Glycerophospholipid metabolism (15)
- Circadian rhythm - mammal (14)
- Nitrogen metabolism (14)
- Asthma (13)
- Basal transcription factors (13)
- Cardiac muscle contraction (13)
- Other glycan degradation (13)
- Methane metabolism (11)
- RNA degradation (11)
- leucine and isoleucine biosynthesis (11)
- Pantothenate and CoA biosynthesis (10)
- Cysteine and methionine metabolism (9)
- Glycosphingolipid biosynthesis - ganglio series (9)
- Taurine and hypotaurine metabolism (9)
- Phenylalanine metabolism (8)
- ABC transporters (6)
- Ascorbate and aldarate metabolism (6)
- Fatty acid biosynthesis (6)
- Limonene and pinene degradation (6)
- Steroid biosynthesis (6)
- Taste transduction (6)
- Porphyrin and chlorophyll metabolism (5)
- Androgen and estrogen metabolism (4)
- C21-Steroid hormone metabolism (4)
- Pentose and glucuronate interconversions (4)
- Aminoacyl-tRNA biosynthesis (3)
- N-Glycan biosynthesis (3)
- Ribosome (3)
- Vitamin B6 metabolism (3)
- Heparan sulfate biosynthesis (2)
- Selenoamino acid metabolism (2)
- Spliceosome (2)
- Chondroitin sulfate biosynthesis (1)
- Nicotinate and nicotinamide metabolism (1)
- O-Glycan biosynthesis (1)
- Riboflavin metabolism (1)
- Sulfur metabolism (1)