Germany
Japan
United Kingdom
China
Antibodies
Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal Anti-BHMT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal Anti-BHMT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT |
Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1. |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
Rabbit Polyclonal Anti-ACAA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Rabbit Polyclonal antibody to PSAT1 (phosphoserine aminotransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 328 of PSAT1 (Uniprot ID#Q9Y617) |
Active filters
Category
- Antibodies
Reactivities
- Rat
Applications
- IHC
Pathways
- Metabolic pathways
Filter by
Target Symbol
- NME1 (132)
- OTC (117)
- PIK3C2A (70)
- ABAT (54)
- LTA4H (51)
- PFKP (51)
- AKR1A1 (49)
- TYMS (48)
- GCH1 (47)
- ACAT2 (45)
- ACAA2 (42)
- HADH (39)
- CMPK1 (35)
- RRM1 (35)
- ACY1 (33)
- GBE1 (30)
- GPI (30)
- GBA (28)
- UPRT (28)
- AK4 (26)
- RPN1 (26)
- AMDHD1 (25)
- CYP2A6 (25)
- GRHPR (25)
- NNMT (25)
- ALOX5 (22)
- DLD (22)
- TH (22)
- ACSS2 (20)
- AK5 (20)
- ALDH1A3 (20)
- DDOST (20)
- OXSM (20)
- PAPSS2 (20)
- PYCR2 (20)
- SMS (20)
- GAD1 (19)
- SDHB (19)
- BHMT (18)
- CAT (17)
- HSD17B10 (17)
- ADH5 (16)
- BDH2 (16)
- IDH1 (16)
- KYNU (16)
- MPI (16)
- NDUFB9 (16)
- POLR2A (16)
- SHMT2 (16)
- TALDO1 (16)
- ACADM (15)
- ASS1 (15)
- ATP6V1C2 (15)
- GAPDH (15)
- NANP (15)
- PGAM2 (15)
- PISD (15)
- ALDOB (13)
- ENO2 (13)
- GLUL (13)
- CPS1 (12)
- FH (12)
- GALNT10 (12)
- GLS2 (12)
- PIKFYVE (12)
- ASL (11)
- ATP6V1B1 (11)
- COX17 (11)
- DHFR (11)
- GUK1 (11)
- HSD17B8 (11)
- NDUFS2 (11)
- PPAT (11)
- RRM2 (11)
- SCP2 (11)
- ADH7 (10)
- ALDH7A1 (10)
- ATP5F1B (10)
- ATP6V1F (10)
- COASY (10)
- FDFT1 (10)
- GATM (10)
- GSS (10)
- HSD17B4 (10)
- MAOA (10)
- MMAB (10)
- NDUFA4L2 (10)
- NDUFB10 (10)
- PAFAH1B3 (10)
- PANK2 (10)
- PDXK (10)
- PHGDH (10)
- PIK3C2B (10)
- PNPO (10)
- PPT1 (10)
- TDO2 (10)
- TYR (10)
- POLR3GL (9)
- ACO2 (8)
- ADH1B (8)