Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | AP |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit Polyclonal Anti-LEFTY2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEFTY2 antibody: synthetic peptide directed towards the N terminal of human LEFTY2. Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK |
Rabbit Polyclonal Anti-DCN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCN antibody: synthetic peptide directed towards the N terminal of human DCN. Synthetic peptide located within the following region: IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL |
Inhibin beta A (INHBA) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This INHBA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-112 amino acids from the N-terminal region of human INHBA. |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
| Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Active filters
Filter by
Target Symbol
- ID3 (37)
- RPS6KB1 (36)
- MYC (32)
- MAPK1 (29)
- SMAD1 (27)
- TNF (19)
- CDKN2B (17)
- NOG (15)
- ID2 (12)
- SMAD3 (12)
- ACVR2A (11)
- TGFBR2 (9)
- MAPK3 (8)
- PPP2R1B (8)
- SMURF2 (8)
- EP300 (7)
- ROCK2 (7)
- BMP4 (6)
- SMAD2 (6)
- SMAD6 (6)
- TGFB1 (6)
- CREBBP (5)
- ACVR1 (4)
- AMH (4)
- CUL1 (4)
- DCN (4)
- ID4 (4)
- IFNG (4)
- INHBA (4)
- PPP2R1A (4)
- ROCK1 (4)
- SMAD4 (4)
- SP1 (4)
- TFDP1 (4)
- TGFB3 (4)
- THBS1 (4)
- ACVR1B (3)
- ACVR1C (3)
- BMP2 (3)
- BMP7 (3)
- E2F4 (3)
- LEFTY2 (3)
- PPP2CA (3)
- SKP1 (3)
- SMAD5 (3)
- SMAD7 (3)
- SMURF1 (3)
- TGFBR1 (3)
- BMP5 (2)
- BMP6 (2)
- BMPR1B (2)
- BMPR2 (2)
- INHBB (2)
- INHBC (2)
- PPP2CB (2)
- RBL2 (2)
- RHOA (2)
- TGFB2 (2)
- ACVR2B (1)
- ACVRL1 (1)
- AMHR2 (1)
- BMP8B (1)
- COMP (1)
- FST (1)
- GDF5 (1)
- GDF6 (1)
- ID1 (1)
- NODAL (1)
- PITX2 (1)
- RBX1 (1)
- RPS6KB2 (1)
- SMAD9 (1)
- THBS2 (1)
- TTK (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (433)
- Transcription Factors (217)
- ES Cell Differentiation/IPS (151)
- Protein Kinase (126)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (111)
- Secreted Protein (91)
- Stem cell relevant signaling - JAK/STAT signaling pathway (84)
- Cancer stem cells (73)
- Embryonic stem cells (69)
- Transmembrane (68)
- Induced pluripotent stem cells (50)
- Stem cell - Pluripotency (36)
- Stem cell relevant signaling - Wnt Signaling pathway (32)
- Adult stem cells (26)
- Phosphatase (17)