Mouse Monoclonal Antibody against Heterogenous Nuclear ribonucleoproteins M3/4 (2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Heterogenous Nuclear ribonucleoproteins M3/4 (2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Rabbit |
Conjugation | Unconjugated |
Calca rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Transferrin (TF) (N-term) mouse monoclonal antibody, clone HTF-14, Purified
Applications | ELISA, FN, IF, IHC, IP, R, WB |
Reactivities | Human, Porcine, Rabbit |
Conjugation | Unconjugated |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Mouse Monoclonal RPE65 Antibody (401.8B11.3D9)
Applications | IHC |
Reactivities | Bovine, Human, Mouse, Porcine |
Conjugation | Unconjugated |
RPE65 mouse monoclonal antibody, clone 401.8B11.3D9
Applications | IF, IHC, IP, WB |
Reactivities | Bovine, Human, Mouse, Porcine |
Conjugation | Unconjugated |
USD 440.00
2 Weeks
Langerin (CD207) mouse monoclonal antibody, clone 310F7.02/HD26
Applications | ELISA, FC, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)
Applications | IHC, IP, WB |
Reactivities | Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against ATG5
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
Applications | IHC, WB |
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
Conjugation | Unconjugated |
Alpha-2-Macroglobulin, (α2M), mouse anti swine, clone PSA24
Applications | ELISA, IHC, WB |
Reactivities | Porcine |
Conjugation | Unconjugated |
Lipocalin 2 (Gelatinase-Associated Lipocalin, NGAL), mouse anti porcine, clone PNL110
Applications | ELISA, IHC, WB |
Reactivities | Porcine |
Conjugation | Unconjugated |
IgG (Immunglobulin G, light chain), mouse anti porcine, clone PHE425
Applications | Tested for immunohistochemistry (IHC), ELISA and Western Blot, other applications not yet tested. Approximate working dilutions: IHC, frozen sections: 0.1µg/ml (1:2000) IHC, paraffin sections: 0.25µg/ml (1:800); Proteinase K pretreatment for antigen retrieval is recommended. Western Blot: 0.05 – 0.5µg/ml. ELISA: 20 - 50ng/ml (EC50 of 1ng/ml illustrated below) Optimal dilutions should be determined by the end user. |
Reactivities | Porcine |
Conjugation | Unconjugated |
USD 580.00
2 Weeks
Reticular Fibroblasts and Reticular Fibres (connective tissue), mouse anti porcine, clone PRF414
Applications | ELISA, IHC |
Reactivities | Porcine |
Conjugation | Unconjugated |
Alpha-2-Macroglobulin, (α2M), mouse anti swine, clone PAP-F101
Applications | IHC |
Reactivities | Porcine |
Conjugation | Unconjugated |
Langerin (CD207) rat monoclonal antibody, clone 929F3.01
Applications | FC, IF, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Alexa Fluor 647 |
USD 440.00
2 Weeks
Mannose Receptor (MRC1) (Extracell. Dom.) mouse monoclonal antibody, clone 122D2.08
Applications | FC, FN, IHC, IP, NEUT, WB |
Reactivities | Human, Porcine, Sheep |
Conjugation | Unconjugated |
Bronchial Basement Cells, mouse anti porcine, clone PLB42
Applications | ELISA, IHC, WB |
Reactivities | Porcine |
Conjugation | Unconjugated |
Langerin (CD207) rat monoclonal antibody, clone 929F3.01
Applications | FC, IF, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Alexa Fluor 488 |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
Applications | FC, IHC, WB |
Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
Conjugation | Unconjugated |
CRP, (C-Reactive Protein), mouse anti porcine, clone PC1 Biotin
Applications | ELISA, IHC |
Reactivities | Porcine |
Conjugation | Biotin |
Hemoglobin beta (Beta-globin), mouse anti porcine, clone PLA114
Applications | ELISA, IHC |
Reactivities | Porcine |
Conjugation | Unconjugated |
Langerin (CD207) rat monoclonal antibody, clone 929F3.01
Applications | FC, IF, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Niemann-Pick C1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Rabbit Polyclonal Ki-67/MKI67 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
HGF (hepatocyte growth factor, scatter factor, SF) mouse anti porcine, clone PG1
Applications | IHC |
Reactivities | Porcine |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Albumin porcine, mouse anti porcine, clone PAL17
Applications | ELISA, IHC, WB |
Reactivities | Porcine |
Conjugation | Unconjugated |
Langerin (CD207) rat monoclonal antibody, clone 929F3.01
Applications | FC, IF, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Alexa Fluor 546 |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
USD 440.00
2 Weeks
Langerin (CD207) mouse monoclonal antibody, clone 306G9.01/HD24
Applications | FC, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against ADFP
Applications | IHC, WB |
Reactivities | Bovine, Human, Monkey, Mouse, Porcine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human protein, within residues 150-250. [Swiss-Prot# Q99541] |
Rabbit Polyclonal Antibody against LOX
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Cow |
Conjugation | Unconjugated |
Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal Pyruvate Carboxylase Antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498] |
Mouse Monoclonal VEGF Antibody (VG76e)
Applications | IHC, WB |
Reactivities | Human, Bovine, Porcine, Sheep |
Conjugation | Unconjugated |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the human LC3 protein (within residues 50-120). [Swiss-Prot Q9H492] |
Neutrophils, mouse anti porcine, clone PM1 Biotin
Applications | IHC |
Reactivities | Porcine |
Conjugation | Biotin |
USD 490.00
2 Weeks
Langerin (CD207) mouse monoclonal antibody, clone 310F7.02/HD26
Applications | ELISA, FC, IHC |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Biotin |
Doublecortin (DCX) mouse monoclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Doublecortin (DCX) mouse monoclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Chicken, Equine, Human, Mouse, Porcine, Primate, Rat |
Conjugation | Unconjugated |
Aurora B (AURKB) mouse monoclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Chicken, Equine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Aurora C (AURKC) mouse monoclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Chicken, Equine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
PGP9.5 (UCHL1) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-UBB Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
Conjugation | Unconjugated |
Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Rabbit Polyclonal LOX propeptide Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301] |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Canine, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Rabbit Polyclonal beta-Actin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine, Avian, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709]. |
Rabbit Polyclonal Lgr5/GPR49 Antibody
Applications | IHC |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the human GPR49/LGR5 protein (within residues 650-700). [Swiss-Prot# O75473] |
Rabbit Polyclonal TLR5 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Porcine |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |