Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
USD 380.00
2 Weeks
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CRY1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Families
- Druggable Genome
Citations
- Yes
Filter by
Category
Target Symbol
- COL1A1 (5)
- BAX (3)
- ABCC4 (2)
- AOX1 (2)
- BAG3 (2)
- BDNF (2)
- CAMK2A (2)
- CCNB1 (2)
- CCR6 (2)
- CTNNB1 (2)
- CTSD (2)
- CXCL12 (2)
- DRD2 (2)
- GAD1 (2)
- HMMR (2)
- IL6 (2)
- NFKB1 (2)
- PLIN2 (2)
- RAB27A (2)
- RELA (2)
- RXFP1 (2)
- SERPINA3 (2)
- ZEB2 (2)
- ABCC5 (1)
- ABCG2 (1)
- ACSL4 (1)
- ADAM10 (1)
- ADAMDEC1 (1)
- ADAMTS1 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- ADH5 (1)
- AKAP12 (1)
- AKT1 (1)
- ALPG (1)
- ANTXR1 (1)
- ANXA1 (1)
- APAF1 (1)
- AQP4 (1)
- ASAH1 (1)
- ATG5 (1)
- ATRX (1)
- BABAM2 (1)
- BCL2L10 (1)
- BCL2L11 (1)
- BCL2L2 (1)
- BID (1)
- BLK (1)
- BMP6 (1)
- BRCA1 (1)
- BRCA2 (1)
- CALCRL (1)
- CAMK1D (1)
- CANX (1)
- CASP9 (1)
- CAV1 (1)
- CBS (1)
- CCND2 (1)
- CCNE1 (1)
- CD19 (1)
- CD274 (1)
- CD276 (1)
- CD4 (1)
- CD46 (1)
- CD81 (1)
- CD8A (1)
- CDH3 (1)
- CDH5 (1)
- CDK6 (1)
- CDKN2A (1)
- CDKN2B (1)
- CEBPA (1)
- CENPE (1)
- CHGA (1)
- CHRM1 (1)
- CHRNA4 (1)
- CP (1)
- CRY1 (1)
- CTLA4 (1)
- CX3CR1 (1)
- CYP19A1 (1)
- CYP1A1 (1)
- CYP24A1 (1)
- CYP27A1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- CYP8B1 (1)
- DAPK1 (1)
- DBH (1)
- DCN (1)
- DDR1 (1)
- DLL4 (1)
- DNASE1 (1)
- DRD1 (1)
- EFNA1 (1)
- EGFR (1)
- ERBB2 (1)
- ERCC6 (1)
- EZH1 (1)
- FABP4 (1)
Reactivities
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (50)
- Focal adhesion (31)
- Metabolic pathways (26)
- Cytokine-cytokine receptor interaction (23)
- Chemokine signaling pathway (20)
- Toll-like receptor signaling pathway (20)
- MAPK signaling pathway (19)
- Prostate cancer (19)
- Neurotrophin signaling pathway (18)
- Pancreatic cancer (18)
- Small cell lung cancer (18)
- Apoptosis (17)
- ECM-receptor interaction (16)
- Neuroactive ligand-receptor interaction (16)
- Adipocytokine signaling pathway (15)
- Colorectal cancer (15)
- Regulation of actin cytoskeleton (15)
- p53 signaling pathway (15)
- T cell receptor signaling pathway (14)
- Glioma (13)
- Jak-STAT signaling pathway (13)
- Leukocyte transendothelial migration (13)
- Calcium signaling pathway (12)
- Hematopoietic cell lineage (12)
- Huntington's disease (12)
- NOD-like receptor signaling pathway (12)
- Adherens junction (11)
- Cell adhesion molecules (CAMs) (11)
- ErbB signaling pathway (11)
- Melanoma (11)
- Acute myeloid leukemia (10)
- B cell receptor signaling pathway (10)
- Chronic myeloid leukemia (10)
- Cytosolic DNA-sensing pathway (10)
- Gap junction (10)
- Insulin signaling pathway (10)
- Non-small cell lung cancer (10)
- RIG-I-like receptor signaling pathway (10)
- Endometrial cancer (9)
- Natural killer cell mediated cytotoxicity (9)
- Progesterone-mediated oocyte maturation (9)
- Renal cell carcinoma (9)
- Alzheimer's disease (8)
- Amyotrophic lateral sclerosis (ALS) (8)
- Cell cycle (8)
- Epithelial cell signaling in Helicobacter pylori infection (8)
- Melanogenesis (8)
- Oocyte meiosis (8)
- VEGF signaling pathway (8)
- Wnt signaling pathway (8)
- Axon guidance (7)
- Fc epsilon RI signaling pathway (7)
- GnRH signaling pathway (7)
- Bladder cancer (6)
- Endocytosis (6)
- Fc gamma R-mediated phagocytosis (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Lysosome (6)
- PPAR signaling pathway (6)
- Pathogenic Escherichia coli infection (6)
- Prion diseases (6)
- TGF-beta signaling pathway (6)
- Tight junction (6)
- Type I diabetes mellitus (6)
- Type II diabetes mellitus (6)
- mTOR signaling pathway (6)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (5)
- Complement and coagulation cascades (5)
- Dilated cardiomyopathy (5)
- Graft-versus-host disease (5)
- ABC transporters (4)
- Antigen processing and presentation (4)
- Basal cell carcinoma (4)
- Drug metabolism - cytochrome P450 (4)
- Long-term potentiation (4)
- Parkinson's disease (4)
- Tyrosine metabolism (4)
- Vascular smooth muscle contraction (4)
- Viral myocarditis (4)
- Alanine (3)
- Allograft rejection (3)
- Autoimmune thyroid disease (3)
- Butanoate metabolism (3)
- Metabolism of xenobiotics by cytochrome P450 (3)
- Phosphatidylinositol signaling system (3)
- Porphyrin and chlorophyll metabolism (3)
- Primary bile acid biosynthesis (3)
- Primary immunodeficiency (3)
- Retinol metabolism (3)
- Taurine and hypotaurine metabolism (3)
- Tryptophan metabolism (3)
- Valine (3)
- aspartate and glutamate metabolism (3)
- beta-Alanine metabolism (3)
- leucine and isoleucine degradation (3)
- Asthma (2)
- Base excision repair (2)
- Citrate cycle (TCA cycle) (2)
- Dorso-ventral axis formation (2)
- Fatty acid metabolism (2)
- Folate biosynthesis (2)
- Fructose and mannose metabolism (2)
- Glycolysis / Gluconeogenesis (2)
- Hedgehog signaling pathway (2)
- Homologous recombination (2)
- Long-term depression (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Notch signaling pathway (2)
- Olfactory transduction (2)
- Purine metabolism (2)
- Regulation of autophagy (2)
- SNARE interactions in vesicular transport (2)
- Sphingolipid metabolism (2)
- Starch and sucrose metabolism (2)
- Systemic lupus erythematosus (2)
- Thyroid cancer (2)
- Ubiquitin mediated proteolysis (2)
- Vibrio cholerae infection (2)
- Vitamin B6 metabolism (2)
- Androgen and estrogen metabolism (1)
- Arachidonic acid metabolism (1)
- Circadian rhythm - mammal (1)
- Cysteine and methionine metabolism (1)
- DNA replication (1)
- Drug metabolism - other enzymes (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycine (1)
- Glycosaminoglycan degradation (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Inositol phosphate metabolism (1)
- Linoleic acid metabolism (1)
- Methane metabolism (1)
- Nucleotide excision repair (1)
- Other glycan degradation (1)
- Oxidative phosphorylation (1)
- Propanoate metabolism (1)
- Proteasome (1)
- Pyruvate metabolism (1)
- Renin-angiotensin system (1)
- Riboflavin metabolism (1)
- Selenoamino acid metabolism (1)
- Steroid biosynthesis (1)
- Thiamine metabolism (1)
- serine and threonine metabolism (1)