Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human E2F6 |
TA349302 is a possible alternative to TA324290.
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
USD 380.00
4 Weeks
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal Anti-SPIB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SPIB antibody was raised against a 17 amino acid peptide near the carboxy terminus of human SPIB. The immunogen is located within amino acids 200 - 250 of SPIB. |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HOXA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the C terminal of human HOXA5. Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG |
Active filters
Reactivities
- Mouse
Applications
- IHC
Clonalities
- Polyclonal
Families
- Transcription Factors
Filter by
Target Symbol
- STAT1 (11)
- ATF2 (10)
- ESR1 (10)
- HDAC2 (10)
- RELA (10)
- CREB1 (9)
- NR3C1 (8)
- SMAD3 (8)
- FOS (7)
- JUN (7)
- SOX2 (7)
- STAT3 (7)
- STAT5B (7)
- FOXO1 (6)
- HDAC5 (6)
- JUND (6)
- KDM1A (6)
- EIF2AK2 (5)
- HDAC1 (5)
- PIAS2 (5)
- PPARG (5)
- PRKCQ (5)
- SMAD1 (5)
- TP53 (5)
- CALR (4)
- CCNE1 (4)
- CTNNB1 (4)
- ENO1 (4)
- FOXO3 (4)
- FOXO4 (4)
- HDAC6 (4)
- HIF1A (4)
- HMGB1 (4)
- IKBKG (4)
- JUNB (4)
- KAT5 (4)
- KLF4 (4)
- MEF2A (4)
- MEF2C (4)
- MYC (4)
- NFE2L2 (4)
- NFKBIE (4)
- PARP1 (4)
- PAX3 (4)
- RAB25 (4)
- RB1 (4)
- SMAD4 (4)
- STAT4 (4)
- SUMO1 (4)
- TCF3 (4)
- XBP1 (4)
- XRCC6 (4)
- ABL1 (3)
- AHR (3)
- APEX1 (3)
- CBFB (3)
- CCNC (3)
- CCNT1 (3)
- CDK7 (3)
- CDX2 (3)
- CERS5 (3)
- DLX5 (3)
- DNMT1 (3)
- DTX1 (3)
- E2F6 (3)
- EIF4G2 (3)
- ELK1 (3)
- ETV6 (3)
- FOXA2 (3)
- FOXP1 (3)
- FOXP3 (3)
- GATA3 (3)
- HCLS1 (3)
- HDAC8 (3)
- HNF1A (3)
- HNF1B (3)
- HNRNPD (3)
- ID4 (3)
- IRF3 (3)
- IRF7 (3)
- KAT7 (3)
- KDM4A (3)
- LIN28A (3)
- MCM2 (3)
- MCM5 (3)
- MYB (3)
- NFKB1 (3)
- NFKB2 (3)
- NFKBIB (3)
- OLIG2 (3)
- PAX8 (3)
- PDX1 (3)
- PIAS1 (3)
- POU2F1 (3)
- POU5F1 (3)
- PRDX3 (3)
- PTMA (3)
- RAD51 (3)
- RAN (3)
- RARA (3)
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (186)
- MAPK signaling pathway (96)
- Cell cycle (85)
- Chronic myeloid leukemia (80)
- Pancreatic cancer (68)
- Wnt signaling pathway (63)
- Prostate cancer (62)
- T cell receptor signaling pathway (59)
- Chemokine signaling pathway (56)
- Toll-like receptor signaling pathway (56)
- Jak-STAT signaling pathway (54)
- TGF-beta signaling pathway (54)
- Small cell lung cancer (53)
- B cell receptor signaling pathway (51)
- Acute myeloid leukemia (50)
- Neurotrophin signaling pathway (50)
- Adipocytokine signaling pathway (48)
- Huntington's disease (47)
- Colorectal cancer (45)
- Apoptosis (34)
- RIG-I-like receptor signaling pathway (31)
- Cytosolic DNA-sensing pathway (30)
- ErbB signaling pathway (29)
- Epithelial cell signaling in Helicobacter pylori infection (26)
- Ubiquitin mediated proteolysis (26)
- NOD-like receptor signaling pathway (25)
- Adherens junction (23)
- Notch signaling pathway (23)
- Renal cell carcinoma (23)
- Thyroid cancer (23)
- Endometrial cancer (21)
- Maturity onset diabetes of the young (20)
- Metabolic pathways (20)
- Bladder cancer (19)
- Melanogenesis (19)
- Non-small cell lung cancer (18)
- p53 signaling pathway (18)
- Tight junction (17)
- Antigen processing and presentation (16)
- Focal adhesion (16)
- Insulin signaling pathway (15)
- Melanoma (15)
- Natural killer cell mediated cytotoxicity (14)
- Oocyte meiosis (14)
- Axon guidance (13)
- Basal cell carcinoma (13)
- DNA replication (13)
- Glioma (13)
- Neuroactive ligand-receptor interaction (13)
- Basal transcription factors (12)
- Amyotrophic lateral sclerosis (ALS) (11)
- Base excision repair (11)
- Endocytosis (11)
- GnRH signaling pathway (11)
- PPAR signaling pathway (10)
- Pathogenic Escherichia coli infection (10)
- VEGF signaling pathway (10)
- RNA degradation (9)
- Viral myocarditis (9)
- Alzheimer's disease (8)
- Cytokine-cytokine receptor interaction (8)
- Type II diabetes mellitus (8)
- Systemic lupus erythematosus (7)
- Allograft rejection (6)
- Dilated cardiomyopathy (6)
- Graft-versus-host disease (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Nucleotide excision repair (6)
- Type I diabetes mellitus (6)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (5)
- Cysteine and methionine metabolism (5)
- Dorso-ventral axis formation (5)
- Leukocyte transendothelial migration (5)
- Purine metabolism (5)
- Pyrimidine metabolism (5)
- Vascular smooth muscle contraction (5)
- Circadian rhythm - mammal (4)
- Fc epsilon RI signaling pathway (4)
- Glycolysis / Gluconeogenesis (4)
- Long-term potentiation (4)
- Non-homologous end-joining (4)
- Primary immunodeficiency (4)
- mTOR signaling pathway (4)
- Asthma (3)
- Autoimmune thyroid disease (3)
- Calcium signaling pathway (3)
- Cell adhesion molecules (CAMs) (3)
- Fc gamma R-mediated phagocytosis (3)
- Hedgehog signaling pathway (3)
- Hematopoietic cell lineage (3)
- Homologous recombination (3)
- Long-term depression (3)
- Prion diseases (3)
- RNA polymerase (3)
- Progesterone-mediated oocyte maturation (2)
- Proteasome (2)
- Regulation of actin cytoskeleton (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Biosynthesis of unsaturated fatty acids (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Ribosome (1)
- Spliceosome (1)
- serine and threonine metabolism (1)