Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Mouse Monoclonal TFRC (CD71) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN |
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
USD 515.00
In Stock
Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
Rabbit Polyclonal Anti-PSMA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Rabbit Polyclonal Anti-ST14 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST14 antibody: synthetic peptide directed towards the C terminal of human ST14. Synthetic peptide located within the following region: SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT |
Rabbit anti-CFB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CFB |
Active filters
Applications
- IHC
Families
- Protease
Filter by
Target Symbol
- SENP2 (64)
- CTSL (52)
- MGLL (52)
- LTA4H (51)
- NAPSA (47)
- CFI (41)
- MMP13 (41)
- KLK3 (38)
- FOLH1 (36)
- USP7 (36)
- PSMB9 (35)
- ACY1 (34)
- ENPEP (34)
- MMP3 (34)
- PSMA6 (34)
- CPM (30)
- MME (30)
- EPHX1 (29)
- SIL1 (27)
- USP5 (26)
- NLN (25)
- DPP9 (24)
- HGF (23)
- ANPEP (22)
- CASP3 (22)
- CLPP (22)
- MMP7 (22)
- CPA2 (21)
- OTUB1 (21)
- MALT1 (19)
- C1S (18)
- KYNU (17)
- PRTN3 (16)
- UCHL1 (16)
- USP10 (16)
- XPNPEP3 (16)
- ADAMTS1 (15)
- CFLAR (15)
- CPA1 (15)
- GZMB (15)
- MIPEP (15)
- PSMA4 (15)
- RNPEP (15)
- USP44 (15)
- CASP7 (14)
- CASP9 (14)
- DPP10 (14)
- MMP2 (14)
- MMP9 (14)
- ACE (12)
- ATG4B (11)
- C2 (11)
- CAPN5 (11)
- CASP1 (11)
- LTF (11)
- OSGEP (11)
- PPAT (11)
- PROZ (11)
- PSMA2 (11)
- PSMB7 (11)
- SPG7 (11)
- USP13 (11)
- USP36 (11)
- USP40 (11)
- CAPN9 (10)
- CNDP2 (10)
- COPS5 (10)
- DPP4 (10)
- HABP2 (10)
- PEPD (10)
- XPNPEP1 (10)
- ADAMTS4 (9)
- HP (9)
- MMP1 (8)
- SENP8 (8)
- CNDP1 (7)
- DPP3 (7)
- F12 (7)
- PLAT (7)
- PLAU (7)
- PLG (7)
- PSMA7 (7)
- TFRC (7)
- ADAM20 (6)
- ADAMTS5 (6)
- CASP6 (6)
- CASP8 (6)
- CTSD (6)
- DPP8 (6)
- F7 (6)
- KLK2 (6)
- THOP1 (6)
- TMPRSS5 (6)
- UQCRC1 (6)
- AGTPBP1 (5)
- CAPN2 (5)
- CASP4 (5)
- CFB (5)
- CPB2 (5)
- CTSK (5)
Reactivities
- Human (1847)
- Mouse (1110)
- Rat (1074)
- Monkey (238)
- Dog (225)
- Bovine (25)
- Pig (16)
- Rabbit (12)
- Horse (8)
- Canine (6)
- Gorilla (6)
- Hamster (6)
- Gibbon (5)
- Bat (4)
- Cow (4)
- Gerbil (4)
- Orang-Utan (4)
- Xenopus (4)
- Chicken (3)
- Chimpanzee (3)
- Rhesus Monkey (3)
- Primate (2)
- X. tropicalis (2)
- Zebrafish (2)
- Porcine (1)
- Sheep (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Metabolic pathways (208)
- Pathways in cancer (139)
- Renin-angiotensin system (135)
- Complement and coagulation cascades (132)
- Proteasome (132)
- Lysosome (131)
- Alzheimer's disease (118)
- Wnt signaling pathway (89)
- Apoptosis (87)
- Parkinson's disease (66)
- Hematopoietic cell lineage (59)
- Antigen processing and presentation (58)
- Arachidonic acid metabolism (55)
- Glycerolipid metabolism (52)
- Prostate cancer (52)
- Huntington's disease (49)
- Amyotrophic lateral sclerosis (ALS) (47)
- Viral myocarditis (42)
- p53 signaling pathway (42)
- Natural killer cell mediated cytotoxicity (37)
- Bladder cancer (36)
- Colorectal cancer (36)
- Arginine and proline metabolism (34)
- Systemic lupus erythematosus (32)
- Metabolism of xenobiotics by cytochrome P450 (29)
- Focal adhesion (28)
- Leukocyte transendothelial migration (28)
- Epithelial cell signaling in Helicobacter pylori infection (26)
- Glutathione metabolism (26)
- Cytokine-cytokine receptor interaction (23)
- Melanoma (23)
- Renal cell carcinoma (23)
- MAPK signaling pathway (22)
- B cell receptor signaling pathway (19)
- T cell receptor signaling pathway (19)
- GnRH signaling pathway (18)
- NOD-like receptor signaling pathway (18)
- Regulation of autophagy (18)
- Tryptophan metabolism (17)
- Type I diabetes mellitus (16)
- Allograft rejection (15)
- Autoimmune thyroid disease (15)
- Graft-versus-host disease (15)
- Alanine (14)
- Endometrial cancer (14)
- Non-small cell lung cancer (14)
- Pancreatic cancer (14)
- Small cell lung cancer (14)
- VEGF signaling pathway (14)
- aspartate and glutamate metabolism (14)
- Hypertrophic cardiomyopathy (HCM) (12)
- Neuroactive ligand-receptor interaction (12)
- Cytosolic DNA-sensing pathway (11)
- Purine metabolism (11)
- RIG-I-like receptor signaling pathway (10)
- PPAR signaling pathway (8)
- Cardiac muscle contraction (7)
- Endocytosis (7)
- Histidine metabolism (7)
- Oxidative phosphorylation (7)
- beta-Alanine metabolism (7)
- Notch signaling pathway (6)
- Toll-like receptor signaling pathway (6)
- Protein export (5)
- Cyanoamino acid metabolism (4)
- Selenoamino acid metabolism (4)
- Taurine and hypotaurine metabolism (4)
- Amino sugar and nucleotide sugar metabolism (3)
- Hedgehog signaling pathway (3)
- Neurotrophin signaling pathway (3)
- Cell cycle (2)
- Folate biosynthesis (2)
- Oocyte meiosis (2)
- Regulation of actin cytoskeleton (2)
- Basal transcription factors (1)
- Other glycan degradation (1)