Germany
Japan
United Kingdom
China
Antibodies
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
USD 399.00
In Stock
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
USD 430.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 240.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Equine, Human |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P4, Azide Free
| Applications | FC, FN, IHC, IP, WB |
| Reactivities | Human |
Carrier-free (BSA/glycerol-free) TIGIT mouse monoclonal antibody, clone OTI8G7
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
TIGIT mouse monoclonal antibody, clone OTI8G7
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Families
- Transmembrane
Filter by
Target Symbol
- MSMB (121)
- KLK8 (113)
- ERBB2 (108)
- PECAM1 (107)
- ABCB1 (90)
- CD4 (85)
- CD99 (78)
- PTPRC (76)
- APP (68)
- MLANA (63)
- BCL2 (62)
- EGFR (59)
- CD68 (58)
- KIT (58)
- NCAM1 (57)
- BSG (56)
- MS4A1 (56)
- EPCAM (55)
- PDCD1 (54)
- CDH1 (52)
- NPR3 (52)
- PROCR (51)
- CD163 (50)
- PTPRE (49)
- RET (48)
- SYP (48)
- CD44 (47)
- CR2 (47)
- POR (47)
- FCGR2A (46)
- CD63 (43)
- L1CAM (43)
- CYP1A2 (42)
- MUC1 (42)
- PDCD1LG2 (41)
- TNFRSF8 (41)
- CD40 (40)
- GOLM1 (39)
- APMAP (36)
- CD2 (36)
- FOLH1 (36)
- GPR17 (36)
- CD8A (35)
- TAPBPL (35)
- ACE2 (34)
- CD34 (34)
- ENPEP (34)
- VIP (34)
- CD1C (33)
- FCER2 (33)
- FGG (33)
- MCL1 (33)
- SLC2A5 (33)
- CD80 (31)
- PMEL (31)
- CD14 (30)
- ILVBL (30)
- MME (30)
- MTDH (30)
- UBE2J1 (30)
- CD19 (29)
- CD5 (29)
- FBXW7 (28)
- ROR2 (28)
- CD22 (27)
- ROS1 (27)
- SIL1 (27)
- SRPRB (27)
- SYT4 (27)
- CD79B (26)
- CYP2A6 (26)
- ERBB3 (26)
- PCDH7 (26)
- RPN1 (26)
- ANO1 (25)
- LGR5 (25)
- MCAM (25)
- SEMA4D (25)
- SDC1 (24)
- CD74 (23)
- HGF (23)
- MET (23)
- MSR1 (23)
- VCAM1 (23)
- ANPEP (22)
- BAX (22)
- FGFR2 (22)
- MSLN (22)
- TNFRSF10B (22)
- WFDC2 (22)
- WNT3 (22)
- CDCP1 (21)
- CSF2RB (21)
- CYP2E1 (21)
- HMOX2 (21)
- ITGB3 (21)
- PON3 (21)
- AGPAT5 (20)
- DDOST (20)
- FATE1 (20)
Reactivities
- Human (8608)
- Mouse (4003)
- Rat (3697)
- Monkey (514)
- Dog (391)
- Bovine (173)
- Gorilla (136)
- Rabbit (115)
- Pig (105)
- Gibbon (102)
- Horse (101)
- Hamster (100)
- Bat (90)
- Chicken (47)
- Chimpanzee (37)
- Xenopus (36)
- Orang-Utan (29)
- Primate (29)
- Cow (27)
- Guinea Pig (24)
- Zebrafish (21)
- Rhesus Monkey (18)
- Canine (11)
- Porcine (7)
- Sheep (7)
- Macaque (6)
- X. tropicalis (5)
- Drosophila (4)
- Equine (4)
- Feline (3)
- Goat (3)
- Avian (1)
- Baboon (1)
- Marmoset (1)
- Mink (1)
- Opossum (1)
- Pufferfish (1)
- Quail (1)
- Squirrel (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Pathways
- Cell adhesion molecules (CAMs) (1162)
- Hematopoietic cell lineage (916)
- Cytokine-cytokine receptor interaction (791)
- Pathways in cancer (788)
- Neuroactive ligand-receptor interaction (598)
- Metabolic pathways (556)
- Calcium signaling pathway (483)
- Focal adhesion (431)
- Endocytosis (415)
- Leukocyte transendothelial migration (336)
- Adherens junction (318)
- Prostate cancer (318)
- T cell receptor signaling pathway (308)
- Primary immunodeficiency (303)
- Regulation of actin cytoskeleton (303)
- MAPK signaling pathway (293)
- Colorectal cancer (255)
- Bladder cancer (249)
- Endometrial cancer (235)
- ErbB signaling pathway (234)
- Alzheimer's disease (232)
- Pancreatic cancer (227)
- Melanoma (225)
- Apoptosis (215)
- Toll-like receptor signaling pathway (205)
- Melanogenesis (186)
- Non-small cell lung cancer (186)
- Systemic lupus erythematosus (186)
- Antigen processing and presentation (185)
- ECM-receptor interaction (170)
- Gap junction (170)
- Lysosome (169)
- Amyotrophic lateral sclerosis (ALS) (167)
- Axon guidance (167)
- ABC transporters (158)
- Fc gamma R-mediated phagocytosis (153)
- B cell receptor signaling pathway (152)
- Jak-STAT signaling pathway (152)
- Neurotrophin signaling pathway (151)
- Renin-angiotensin system (143)
- Allograft rejection (128)
- Viral myocarditis (128)
- Drug metabolism - cytochrome P450 (125)
- Dilated cardiomyopathy (121)
- Hypertrophic cardiomyopathy (HCM) (120)
- Autoimmune thyroid disease (119)
- Natural killer cell mediated cytotoxicity (118)
- Glioma (117)
- Complement and coagulation cascades (116)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (114)
- Pathogenic Escherichia coli infection (110)
- Thyroid cancer (110)
- Epithelial cell signaling in Helicobacter pylori infection (109)
- Small cell lung cancer (108)
- Adipocytokine signaling pathway (107)
- Retinol metabolism (106)
- Parkinson's disease (104)
- Chemokine signaling pathway (99)
- Basal cell carcinoma (98)
- Huntington's disease (98)
- Wnt signaling pathway (94)
- Linoleic acid metabolism (91)
- Type I diabetes mellitus (91)
- Metabolism of xenobiotics by cytochrome P450 (90)
- GnRH signaling pathway (88)
- Prion diseases (87)
- Graft-versus-host disease (83)
- Vascular smooth muscle contraction (81)
- Hedgehog signaling pathway (78)
- Asthma (75)
- N-Glycan biosynthesis (72)
- Caffeine metabolism (71)
- TGF-beta signaling pathway (68)
- PPAR signaling pathway (67)
- Acute myeloid leukemia (65)
- Dorso-ventral axis formation (64)
- Arachidonic acid metabolism (62)
- Tight junction (62)
- Ubiquitin mediated proteolysis (61)
- Renal cell carcinoma (60)
- Tryptophan metabolism (60)
- p53 signaling pathway (58)
- Long-term potentiation (55)
- SNARE interactions in vesicular transport (52)
- Cardiac muscle contraction (51)
- Oxidative phosphorylation (51)
- Purine metabolism (50)
- RIG-I-like receptor signaling pathway (50)
- Drug metabolism - other enzymes (47)
- Long-term depression (44)
- Fatty acid metabolism (43)
- Porphyrin and chlorophyll metabolism (42)
- Sphingolipid metabolism (42)
- Chronic myeloid leukemia (41)
- Vibrio cholerae infection (39)
- Type II diabetes mellitus (38)
- Notch signaling pathway (35)
- Tyrosine metabolism (33)
- Glutathione metabolism (31)
- Insulin signaling pathway (31)
- Nicotinate and nicotinamide metabolism (31)
- Nitrogen metabolism (30)
- O-Glycan biosynthesis (29)
- Riboflavin metabolism (29)
- Starch and sucrose metabolism (28)
- Cytosolic DNA-sensing pathway (27)
- Olfactory transduction (27)
- Taste transduction (27)
- NOD-like receptor signaling pathway (26)
- Glycerolipid metabolism (25)
- Biosynthesis of unsaturated fatty acids (24)
- Androgen and estrogen metabolism (22)
- Fc epsilon RI signaling pathway (21)
- Oocyte meiosis (21)
- Glycosphingolipid biosynthesis - lacto and neolacto series (20)
- Progesterone-mediated oocyte maturation (20)
- Pyrimidine metabolism (20)
- Glycerophospholipid metabolism (19)
- Primary bile acid biosynthesis (18)
- Keratan sulfate biosynthesis (17)
- Steroid biosynthesis (17)
- VEGF signaling pathway (17)
- Ascorbate and aldarate metabolism (16)
- Glycolysis / Gluconeogenesis (16)
- Ether lipid metabolism (13)
- Propanoate metabolism (13)
- Valine (13)
- leucine and isoleucine degradation (13)
- Arginine and proline metabolism (12)
- Chondroitin sulfate biosynthesis (12)
- Histidine metabolism (12)
- Other glycan degradation (12)
- Heparan sulfate biosynthesis (11)
- beta-Alanine metabolism (11)
- Pentose and glucuronate interconversions (10)
- Butanoate metabolism (9)
- Galactose metabolism (9)
- Limonene and pinene degradation (9)
- Lysine degradation (9)
- Pantothenate and CoA biosynthesis (9)
- Pyruvate metabolism (9)
- C21-Steroid hormone metabolism (8)
- Amino sugar and nucleotide sugar metabolism (6)
- Cell cycle (6)
- Glycosaminoglycan degradation (6)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (6)
- Phosphatidylinositol signaling system (6)
- Glycine (5)
- Glycosphingolipid biosynthesis - ganglio series (5)
- Glycosphingolipid biosynthesis - globo series (5)
- Inositol phosphate metabolism (5)
- Phenylalanine metabolism (5)
- Protein export (5)
- serine and threonine metabolism (5)
- Cyanoamino acid metabolism (4)
- Selenoamino acid metabolism (4)
- Taurine and hypotaurine metabolism (4)
- Maturity onset diabetes of the young (3)
- O-Mannosyl glycan biosynthesis (2)
- alpha-Linolenic acid metabolism (2)
- Base excision repair (1)
- Sulfur metabolism (1)
- Terpenoid backbone biosynthesis (1)