Germany
Japan
United Kingdom
China
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
Download
.jpg?d=110x100 "User supplied image")
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Rabbit polyclonal FGFR4 (Tyr642) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FGFR4 around the phosphorylation site of tyrosine 642. |
| Modifications | Phospho-specific |
Rabbit Polyclonal SYK (Tyr348) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SYK around the phosphorylation site of Tyrosine 348 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
Rabbit Polyclonal ZIPK Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ZIP kinase antibody was raised against a peptide corresponding to amino acids near the center of human ZIP kinase. The immunogen is located within amino acids 270 - 320 of ZIPK. |
Rabbit Polyclonal antibody to Activin A Receptor type IIA (activin A receptor, type IIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 267 and 513 of Activin A Receptor type IIA (Uniprot ID#P27037) |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CLK2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLK2. |
Rabbit polyclonal MuSK (Tyr755) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MuSK around the phosphorylation site of tyrosine 755. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Applications
- WB
Conjugates
- Unconjugated
Families
- Protein Kinase
Filter by
Target Symbol
- ALK (162)
- MAP2K1 (133)
- MAP2K3 (94)
- ERBB2 (93)
- EGFR (85)
- AKT1 (80)
- MAPK13 (58)
- BRAF (53)
- MAPK1 (43)
- CDK2 (40)
- MTOR (40)
- RET (37)
- LIMK1 (36)
- MAPK7 (35)
- BTK (34)
- PDGFRA (34)
- PRKCE (34)
- MET (33)
- CHEK2 (32)
- MAPKAPK5 (31)
- FGFR2 (29)
- CSNK1G1 (28)
- RPS6KB1 (28)
- CSNK1G2 (27)
- MAPK8 (27)
- NRBP1 (27)
- ERBB3 (26)
- MAPK14 (26)
- MARK3 (25)
- FGFR1 (24)
- PDGFRB (24)
- PLK1 (24)
- RPS6KA2 (24)
- AKT2 (23)
- MAP2K4 (22)
- PIM2 (21)
- PRKD2 (21)
- FRK (20)
- MAK (20)
- PTK2 (20)
- ROR2 (20)
- STK39 (20)
- CDKL1 (19)
- IGF1R (19)
- KDR (19)
- MAP2K2 (19)
- TWF1 (19)
- CDK15 (18)
- CDKL2 (18)
- HIPK1 (18)
- TYRO3 (18)
- MAPK9 (17)
- TRIM28 (17)
- CAMK2B (16)
- ERBB4 (16)
- JAK2 (16)
- PRKCA (16)
- TP53RK (16)
- SRC (15)
- ARAF (14)
- MAP3K7 (14)
- NTRK3 (14)
- RAF1 (14)
- TLK2 (14)
- GSK3B (13)
- MAP3K8 (13)
- MAPK10 (13)
- ACVR2A (12)
- CDK5 (12)
- FLT4 (12)
- MAPK3 (12)
- MAST2 (12)
- NEK6 (12)
- PAK1 (12)
- PAK4 (12)
- PRKCD (12)
- CSNK1E (11)
- LCK (11)
- NTRK2 (11)
- STK11 (11)
- AKT3 (10)
- CHUK (10)
- MOK (10)
- PRKAA1 (10)
- ROCK2 (10)
- SYK (10)
- TGFBR2 (10)
- UHMK1 (10)
- CDK1 (9)
- CSF1R (9)
- FGFR3 (9)
- GSK3A (9)
- MAPK6 (9)
- PKMYT1 (9)
- PRKG2 (9)
- TRIB1 (9)
- GRK1 (8)
- IKBKB (8)
- MAP3K13 (8)
- PRKCB (8)
Antibody Hosts
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
Pathways
- MAPK signaling pathway (1142)
- Pathways in cancer (1064)
- ErbB signaling pathway (913)
- Focal adhesion (888)
- Prostate cancer (824)
- Fc epsilon RI signaling pathway (732)
- Neurotrophin signaling pathway (729)
- GnRH signaling pathway (705)
- Progesterone-mediated oocyte maturation (673)
- Colorectal cancer (664)
- Pancreatic cancer (662)
- Glioma (658)
- Toll-like receptor signaling pathway (646)
- Melanoma (625)
- Non-small cell lung cancer (616)
- Regulation of actin cytoskeleton (613)
- Endometrial cancer (602)
- Insulin signaling pathway (590)
- T cell receptor signaling pathway (575)
- Chemokine signaling pathway (543)
- Acute myeloid leukemia (517)
- VEGF signaling pathway (514)
- Bladder cancer (486)
- Fc gamma R-mediated phagocytosis (485)
- Gap junction (477)
- Renal cell carcinoma (470)
- Chronic myeloid leukemia (447)
- B cell receptor signaling pathway (419)
- Vascular smooth muscle contraction (400)
- Endocytosis (389)
- Long-term potentiation (381)
- Adherens junction (374)
- Natural killer cell mediated cytotoxicity (367)
- Oocyte meiosis (363)
- mTOR signaling pathway (353)
- Calcium signaling pathway (352)
- Long-term depression (351)
- Epithelial cell signaling in Helicobacter pylori infection (342)
- Thyroid cancer (302)
- Melanogenesis (296)
- Adipocytokine signaling pathway (279)
- Dorso-ventral axis formation (273)
- Cytokine-cytokine receptor interaction (265)
- Axon guidance (264)
- NOD-like receptor signaling pathway (239)
- Tight junction (223)
- Prion diseases (219)
- Type II diabetes mellitus (216)
- Amyotrophic lateral sclerosis (ALS) (197)
- Small cell lung cancer (196)
- RIG-I-like receptor signaling pathway (186)
- Wnt signaling pathway (177)
- Leukocyte transendothelial migration (159)
- Cell cycle (158)
- Apoptosis (150)
- TGF-beta signaling pathway (140)
- Jak-STAT signaling pathway (139)
- p53 signaling pathway (97)
- Hedgehog signaling pathway (92)
- Alzheimer's disease (87)
- Primary immunodeficiency (53)
- Olfactory transduction (47)
- Pathogenic Escherichia coli infection (40)
- Vibrio cholerae infection (34)
- Phosphatidylinositol signaling system (27)
- Cytosolic DNA-sensing pathway (22)
- Regulation of autophagy (17)
- Hematopoietic cell lineage (15)
- Hypertrophic cardiomyopathy (HCM) (15)
- Basal cell carcinoma (13)
- Circadian rhythm - mammal (13)
- Viral myocarditis (12)
- PPAR signaling pathway (10)
- Dilated cardiomyopathy (7)
- Taste transduction (7)
- Parkinson's disease (5)
- Purine metabolism (4)
- Nucleotide excision repair (2)
- Ubiquitin mediated proteolysis (2)
- Basal transcription factors (1)