Antibodies

View as table Download

Rabbit Polyclonal TRPC6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6.

Rabbit Polyclonal Anti-Alpha-tubulin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Alpha-tubulin antibody was raised against an 18 amino acid peptide near the amino terminus of human alpha-tubulin

Rabbit Polyclonal TRPC6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRPC6 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC6.

Rabbit Polyclonal Anti-TRPC3 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC3 antibody: synthetic peptide directed towards the n terminal of human TRPC3. Synthetic peptide located within the following region: MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG

Rabbit polyclonal Anti-MCOLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: ENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNK

Rabbit Polyclonal Anti-TRPA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL

Rabbit Polyclonal TRPC3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TRPC3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC3.

Anti-TRPC3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3

Rabbit Polyclonal Anti-MCOLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI

Rabbit Polyclonal TRPC3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRPC3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC3.

Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759)

Rabbit Polyclonal TRPV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Rabbit polyclonal TRPV1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human TRPV1.

Rabbit Polyclonal TRPV4 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRPV4 antibody was raised against an 18 amino acid peptide near the center of human TRPV4. The immunogen is located within amino acids 380 - 430 of TRPV4.

Rabbit Polyclonal Anti-TRPM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK

Rabbit Polyclonal Anti-TRPC6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the N terminal of human TRPC6. Synthetic peptide located within the following region: MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC

Rabbit Polyclonal Anti-TRPC3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRPC3 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TRPC3.

Goat Polyclonal Antibody against TRPV5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SHRGWEILRQNT, from the internal region of the protein sequence according to NP_062815.2.

Rabbit polyclonal TRPM8 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the Central region of human TRPM8.

Rabbit polyclonal TRPC5 Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRPC5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-283 amino acids from the N-terminal region of human TRPC5.

Rabbit polyclonal Anti-TRPV5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Rabbit Polyclonal Anti-TRPM8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP

Goat Polyclonal Antibody against TRPM7

Applications WB
Reactivities Mouse, Rat, CrayFish
Conjugation Unconjugated
Immunogen Peptide with sequence C-TKESESTNSVRLML, from the C Terminus of the protein sequence according to NP_060142.2.

Goat Anti-TRPC4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KHAKEEDSSIDYD, from the internal region (near C-Terminus) of the protein sequence according to NP_057263.1.

Goat Anti-Polycystin 2 / PKD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ERAKLKRREVLGR, from the internal region of the protein sequence according to NP_000288.1.

Rabbit Polyclonal Anti-TRPV4 Antibody

Applications IHC, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

Rabbit Polyclonal Anti-TRPC6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the C terminal of human TRPC6. Synthetic peptide located within the following region: GHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRS

Goat Polyclonal Antibody against TRPC6 (C-terminal)

Applications WB
Reactivities Human
Immunogen Peptide with sequence C-EKLSMEPNQEETNR, from the C Terminus of the protein sequence according to NP_004612.2.

Rabbit Polyclonal Anti-TRPC6 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the middle region of human TRPC6. Synthetic peptide located within the following region: KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE

Rabbit Polyclonal Anti-TRPC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPC4 antibody: synthetic peptide directed towards the middle region of human TRPC4. Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL

Rabbit Polyclonal Anti-TRPM4 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI

Rabbit Polyclonal Anti-Trpv6 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Trpv6 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC

Rabbit Polyclonal Anti-TRPC7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRPC7 antibody is: synthetic peptide directed towards the C-terminal region of Human TRPC7. Synthetic peptide located within the following region: KAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSE

Rabbit Polyclonal Anti-MCOLN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN1 antibody: synthetic peptide directed towards the N terminal of human MCOLN1. Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV

Rabbit Polyclonal Anti-TRPM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD

Rabbit Polyclonal Anti-TRPM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: TPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTY

Rabbit Polyclonal Anti-TRPM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK

Rabbit Polyclonal Anti-TRPM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL

Anti-TRPM5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1029-1043 amino acids of human transient receptor potential cation channel, subfamily M, member 5

Rabbit Polyclonal Anti-TRPM6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRPM6

Rabbit polyclonal anti-TRPV1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TRPV1

Rabbit polyclonal anti-TRPV1 Antibody, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Immunogen Recombinant protein of human TRPV1

Rabbit polyclonal anti-TRPV1 Antibody, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Immunogen Recombinant protein of human TRPV1

Rabbit polyclonal anti-TRPV1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TRPV1