Oct4 (POU5F1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 200-250 of Human Oct-3/4. |
Oct4 (POU5F1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 200-250 of Human Oct-3/4. |
Mouse Monoclonal ApoE4 Antibody (4E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
HPRT1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
PRMT5 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PRMT5 |
Rabbit anti-TMPO Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TMPO |
RBPMS mouse monoclonal antibody,clone 4H6, PE conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | PE |
Rabbit Polyclonal Antibody against Nucleophosmin, mutant - AML Marker
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of human mutant nucleophosmin (exact sequence is within residues 250-298). |
HDAC1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human HDAC1 |
MSH6 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MSH6 |
Rabbit Polyclonal Anti-ANXA3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA3 |
Rabbit Polyclonal Anti-MCM5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MCM5 |
Rabbit Polyclonal Anti-MCM6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MCM6 |
Rabbit Polyclonal Anti-PHB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PHB |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
Rabbit anti-HSPA9 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPA9 |
Rabbit anti-HSP90AB1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSP90AB1 |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PRNP (Clone EP1802Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EWSR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: QPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQS |
Rabbit Polyclonal Anti-FUS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FUS antibody: synthetic peptide directed towards the N terminal of human FUS. Synthetic peptide located within the following region: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY |
Rabbit Polyclonal Anti-SOCS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit Polyclonal Anti-HSPA8 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
Rabbit polyclonal MCM3 (Thr722) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MCM3 around the phosphorylation site of threonine 722. |
Modifications | Phospho-specific |
Anti-POU5F1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-150 amino acids of human POU class 5 homeobox 1 |
Rabbit anti-NFKBIB Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NFKBIB |
Rabbit Polyclonal Anti-ANP32A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A. Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE |
Rabbit Polyclonal Anti-NCL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the N terminal of human NCL. Synthetic peptide located within the following region: GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED |
Rabbit Polyclonal Anti-NCL Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the C terminal of human NCL. Synthetic peptide located within the following region: GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE |
Rabbit Polyclonal Anti-MSH6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Goat Polyclonal Anti-Vimentin Antibody
Applications | FC, IF, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Rabbit polyclonal anti-Cyclin E1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin E1. |
Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
Rabbit Polyclonal Anti-SMN1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMN1 antibody: synthetic peptide directed towards the N terminal of human SMN1. Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV |
Rabbit Polyclonal Anti-FBP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
Rabbit Polyclonal Anti-NP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG |
Rabbit Polyclonal Anti-SOX4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SOX4 antibody was raised against a 16 amino acid peptide near the amino terminus of human SOX4. |
Rabbit Polyclonal Anti-MCM2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MCM2 |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Mouse monoclonal anti-PARP antibody, clone 7A10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal RHAMM Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RHAMM antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human RHAMM. |
STIP1 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human STIP1 |
Mouse Monoclonal anti-P53 Antibody
Applications | IHC, WB |
Reactivities | Human, non-human primates |
Conjugation | Unconjugated |
Rabbit anti-PARP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PARP1 |
Rabbit anti-PRNP Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRNP |
Rabbit anti-GMNN Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GMNN |
Rabbit anti-NUDT1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NUDT1 |