Rabbit Polyclonal TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6. |
Rabbit Polyclonal TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6. |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Alpha-tubulin antibody was raised against an 18 amino acid peptide near the amino terminus of human alpha-tubulin |
Rabbit Polyclonal TRPC6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC6. |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Horse, Human, Monkey, Pig |
Conjugation | Unconjugated |
Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
Rabbit Polyclonal Anti-TRPC3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC3 antibody: synthetic peptide directed towards the n terminal of human TRPC3. Synthetic peptide located within the following region: MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG |
Rabbit polyclonal Anti-MCOLN3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: ENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNK |
Rabbit Polyclonal Anti-TRPA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL |
Rabbit Polyclonal TRPC3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC3. |
Anti-TRPC3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Rabbit Polyclonal Anti-MCOLN3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI |
Rabbit Polyclonal TRPC3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRPC3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human TRPC3. |
Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759) |
Rabbit Polyclonal TRPV1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal TRPV1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human TRPV1. |
Rabbit Polyclonal TRPV4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TRPV4 antibody was raised against an 18 amino acid peptide near the center of human TRPV4. The immunogen is located within amino acids 380 - 430 of TRPV4. |
Rabbit Polyclonal Anti-TRPM2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK |
Rabbit Polyclonal Anti-TRPC6 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the N terminal of human TRPC6. Synthetic peptide located within the following region: MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC |
Rabbit Polyclonal Anti-TRPC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRPC3 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TRPC3. |
Goat Polyclonal Antibody against TRPV5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SHRGWEILRQNT, from the internal region of the protein sequence according to NP_062815.2. |
Rabbit polyclonal TRPM8 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the Central region of human TRPM8. |
Rabbit polyclonal TRPC5 Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TRPC5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-283 amino acids from the N-terminal region of human TRPC5. |
Rabbit polyclonal Anti-TRPV5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA |
Rabbit Polyclonal Anti-TRPM8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP |
Rabbit Polyclonal TRPV6 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Polyclonal Antibody against TRPM7
Applications | WB |
Reactivities | Mouse, Rat, CrayFish |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TKESESTNSVRLML, from the C Terminus of the protein sequence according to NP_060142.2. |
Goat Anti-TRPC4 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHAKEEDSSIDYD, from the internal region (near C-Terminus) of the protein sequence according to NP_057263.1. |
Goat Anti-Polycystin 2 / PKD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ERAKLKRREVLGR, from the internal region of the protein sequence according to NP_000288.1. |
Rabbit Polyclonal Anti-TRPV4 Antibody
Applications | IHC, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR |
Rabbit Polyclonal Anti-TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the C terminal of human TRPC6. Synthetic peptide located within the following region: GHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRS |
Goat Polyclonal Antibody against TRPC6 (C-terminal)
Applications | WB |
Reactivities | Human |
Immunogen | Peptide with sequence C-EKLSMEPNQEETNR, from the C Terminus of the protein sequence according to NP_004612.2. |
TRPV2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from internal region of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (87%). |
TRPV2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from internal region of human TRPV2. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Orangutan (93%); Gibbon, Monkey (80%). |
TRPV4 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
Conjugation | Unconjugated |
Immunogen | TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%). |
TRPV4 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | TRPV4 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human TRPV4. Percent identity with other species by BLAST analysis: Human (100%); Marmoset (94%); Panda, Dog (89%); Hamster, Bovine, Pig (83%). |
Rabbit Polyclonal Anti-TRPC6 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the middle region of human TRPC6. Synthetic peptide located within the following region: KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE |
Rabbit Polyclonal Anti-TRPC4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC4 antibody: synthetic peptide directed towards the middle region of human TRPC4. Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL |
Rabbit Polyclonal Anti-TRPM4 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI |
Rabbit Polyclonal Anti-Trpv6 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Trpv6 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC |
Rabbit Polyclonal Anti-TRPC7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TRPC7 antibody is: synthetic peptide directed towards the C-terminal region of Human TRPC7. Synthetic peptide located within the following region: KAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSE |
Rabbit Polyclonal Anti-MCOLN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCOLN1 antibody: synthetic peptide directed towards the N terminal of human MCOLN1. Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV |
Rabbit Polyclonal Anti-TRPM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD |
Rabbit Polyclonal Anti-TRPM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: TPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTY |
Rabbit Polyclonal Anti-TRPM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK |
Rabbit Polyclonal Anti-TRPM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL |
Anti-TRPC3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 823-836 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Anti-TRPM7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7 |
Anti-TRPM7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1850-1863 amino acids of human transient receptor potential cation channel, subfamily M, member 7 |
Anti-TRPM5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1029-1043 amino acids of human transient receptor potential cation channel, subfamily M, member 5 |
Anti-TRPA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1105-1119 amino acids of human transient receptor potential cation channel, subfamily A, member 1 |
Anti-TRPC6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 919-931 amino acids of human transient receptor potential cation channel, subfamily C, member 6 |
Anti-TRPC6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 919-931 amino acids of human transient receptor potential cation channel, subfamily C, member 6 |