Germany
Japan
United Kingdom
China
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
Download
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal DNA Polymerase theta antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?. |
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, DyLight488 conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | DyLight 488 |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 524.00
In Stock
Rabbit Polyclonal Anti-EWSR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the middle region of human EWSR1. Synthetic peptide located within the following region: QPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQS |
Rabbit Polyclonal Anti-FUS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUS antibody: synthetic peptide directed towards the N terminal of human FUS. Synthetic peptide located within the following region: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit polyclonal MCM3 (Thr722) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MCM3 around the phosphorylation site of threonine 722. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ANP32A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A. Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE |
Rabbit Polyclonal Anti-NCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the N terminal of human NCL. Synthetic peptide located within the following region: GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED |
Rabbit Polyclonal Anti-NCL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCL antibody: synthetic peptide directed towards the C terminal of human NCL. Synthetic peptide located within the following region: GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Rabbit Polyclonal Anti-SMN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMN1 antibody: synthetic peptide directed towards the N terminal of human SMN1. Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV |
Rabbit Polyclonal Anti-FBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
Rabbit Polyclonal Anti-NP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG |
Rabbit anti-PARP1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PARP1 |
Active filters
Reactivities
- Human
Families
- Stem cell - Pluripotency
Filter by
Target Symbol
- TP53 (238)
- NME1 (173)
- PCNA (119)
- BCL2 (89)
- TNFRSF8 (89)
- KIT (80)
- NPPB (73)
- ERBB3 (64)
- BUB1B (59)
- TNNI3 (59)
- MCM2 (58)
- UNG (57)
- APOE (55)
- CHEK2 (53)
- PSMA6 (52)
- HSPD1 (51)
- RBPMS (51)
- RPA2 (51)
- PPM1B (46)
- RFC2 (44)
- BIRC5 (42)
- SPAG5 (42)
- HDAC1 (41)
- MYC (41)
- PXN (39)
- SSB (38)
- EXOSC7 (37)
- TGIF1 (37)
- VASP (37)
- ANXA3 (33)
- TRIM28 (32)
- GNL3 (31)
- CCND1 (30)
- PRMT5 (30)
- EWSR1 (29)
- APEX1 (28)
- PBX1 (27)
- FEN1 (26)
- GEMIN2 (26)
- HSP90AB1 (26)
- LSM1 (26)
- SIRT1 (26)
- TRAIP (26)
- OTX2 (25)
- ZFP42 (25)
- HDAC2 (24)
- POU5F1 (24)
- RFC3 (24)
- ATIC (22)
- HSPA9 (22)
- KPNB1 (22)
- SUPT3H (22)
- WDR77 (22)
- CHEK1 (21)
- STX3 (21)
- PIAS2 (20)
- CASP9 (19)
- HPRT1 (19)
- SUMO1 (19)
- LCK (18)
- PHGDH (18)
- RAD9A (18)
- CCNB1 (17)
- CDK1 (17)
- CTBP2 (17)
- PASK (17)
- COPS6 (16)
- MSH2 (16)
- PARP1 (16)
- PFN1 (16)
- CASP6 (15)
- HSPA8 (15)
- NANOG (15)
- EXOSC3 (14)
- GADD45A (14)
- HMGB1 (14)
- DHFR (13)
- GRB7 (13)
- MSH6 (13)
- PAK1 (13)
- CCNE1 (12)
- CDC45 (12)
- MCM5 (12)
- NFKBIB (12)
- NPM1 (12)
- TARBP2 (12)
- ACTA1 (11)
- MYB (11)
- PTPN6 (11)
- RND1 (11)
- SOCS1 (11)
- XRCC5 (11)
- AURKA (10)
- TRIP13 (10)
- CDC25C (9)
- CDK7 (9)
- COPS3 (9)
- PA2G4 (9)
- RFC4 (9)
- SP1 (9)
Applications
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Cell cycle (839)
- Pathways in cancer (721)
- Colorectal cancer (492)
- Small cell lung cancer (452)
- p53 signaling pathway (441)
- Prostate cancer (416)
- Chronic myeloid leukemia (391)
- DNA replication (372)
- MAPK signaling pathway (371)
- Apoptosis (363)
- Amyotrophic lateral sclerosis (ALS) (351)
- Neurotrophin signaling pathway (339)
- Huntington's disease (336)
- Endometrial cancer (330)
- Wnt signaling pathway (328)
- Bladder cancer (309)
- Thyroid cancer (309)
- Metabolic pathways (298)
- Pancreatic cancer (297)
- Mismatch repair (294)
- Non-small cell lung cancer (289)
- Nucleotide excision repair (283)
- Base excision repair (277)
- Glioma (268)
- Melanoma (268)
- Basal cell carcinoma (238)
- Purine metabolism (225)
- Focal adhesion (216)
- Pyrimidine metabolism (195)
- Cytokine-cytokine receptor interaction (169)
- Endocytosis (160)
- RNA degradation (158)
- Acute myeloid leukemia (151)
- ErbB signaling pathway (122)
- Jak-STAT signaling pathway (113)
- Progesterone-mediated oocyte maturation (94)
- Oocyte meiosis (85)
- Homologous recombination (83)
- Notch signaling pathway (82)
- Hematopoietic cell lineage (80)
- Melanogenesis (80)
- Alzheimer's disease (76)
- Leukocyte transendothelial migration (76)
- Regulation of actin cytoskeleton (76)
- Primary immunodeficiency (75)
- Calcium signaling pathway (67)
- Proteasome (66)
- Chemokine signaling pathway (64)
- VEGF signaling pathway (60)
- Cardiac muscle contraction (59)
- Dilated cardiomyopathy (59)
- Hypertrophic cardiomyopathy (HCM) (59)
- T cell receptor signaling pathway (58)
- Viral myocarditis (56)
- Fc gamma R-mediated phagocytosis (52)
- Type I diabetes mellitus (51)
- TGF-beta signaling pathway (50)
- Antigen processing and presentation (46)
- Non-homologous end-joining (45)
- Spliceosome (44)
- Natural killer cell mediated cytotoxicity (42)
- Systemic lupus erythematosus (41)
- Ubiquitin mediated proteolysis (40)
- NOD-like receptor signaling pathway (38)
- One carbon pool by folate (38)
- Drug metabolism - other enzymes (32)
- Axon guidance (28)
- Gap junction (24)
- Parkinson's disease (24)
- B cell receptor signaling pathway (23)
- SNARE interactions in vesicular transport (22)
- Glycine (18)
- serine and threonine metabolism (18)
- Renal cell carcinoma (17)
- Cysteine and methionine metabolism (15)
- Cytosolic DNA-sensing pathway (15)
- Insulin signaling pathway (14)
- Epithelial cell signaling in Helicobacter pylori infection (13)
- Folate biosynthesis (13)
- Prion diseases (13)
- Adipocytokine signaling pathway (12)
- RIG-I-like receptor signaling pathway (12)
- Adherens junction (11)
- Type II diabetes mellitus (11)
- Alanine (8)
- Arginine and proline metabolism (8)
- Pathogenic Escherichia coli infection (8)
- Phenylalanine (8)
- Phenylalanine metabolism (8)
- Tyrosine metabolism (8)
- aspartate and glutamate metabolism (8)
- tyrosine and tryptophan biosynthesis (8)
- Basal transcription factors (5)
- Fructose and mannose metabolism (3)
- Glycolysis / Gluconeogenesis (3)
- Glyoxylate and dicarboxylate metabolism (3)
- Pentose phosphate pathway (3)
- RNA polymerase (3)
- Steroid biosynthesis (3)
- ECM-receptor interaction (2)
- Ether lipid metabolism (2)
- Glycerolipid metabolism (2)
- Glycerophospholipid metabolism (2)
- Nicotinate and nicotinamide metabolism (2)
- Selenoamino acid metabolism (2)
- Sphingolipid metabolism (2)