Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-PRUNE Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRUNE antibody is: synthetic peptide directed towards the C-terminal region of Human PRUNE. Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Rabbit Polyclonal Anti-NP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG |
Rabbit Polyclonal Anti-PKM2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the middle region of human PKM2. Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ |
Rabbit Polyclonal Anti-PAPSS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPSS2 antibody: synthetic peptide directed towards the C terminal of human PAPSS2. Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN |
Rabbit Polyclonal Anti-PKLR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE |
Rabbit Polyclonal Anti-PRPS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI |
Rabbit polyclonal anti-POLR2C antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This POLR2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the C-terminal region of human POLR2C. |
Rabbit Polyclonal Anti-ADCY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
Rabbit Polyclonal Anti-POLR1E Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR1E antibody: synthetic peptide directed towards the N terminal of human POLR1E. Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL |
Rabbit Polyclonal Anti-POLR3F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the middle region of human POLR3F. Synthetic peptide located within the following region: LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE |
Rabbit Polyclonal Anti-NME7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NME7 |
Rabbit Polyclonal Anti-POLR1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR1B antibody: synthetic peptide directed towards the middle region of human POLR1B. Synthetic peptide located within the following region: SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD |
Rabbit Polyclonal Anti-BACE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BACE1 |
USD 525.00
5 Days
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Active filters
Pathways
- Purine metabolism
Filter by
Target Symbol
- NME1 (177)
- PDE4A (56)
- RRM1 (56)
- NME4 (55)
- PPAT (51)
- AK4 (49)
- AK5 (47)
- PDE2A (47)
- PKLR (44)
- AK1 (35)
- PDE4B (35)
- POLR2H (32)
- PAPSS2 (31)
- ENTPD1 (29)
- FHIT (28)
- DCK (26)
- HPRT1 (25)
- POLR2A (25)
- PAICS (23)
- ATIC (22)
- PDE6G (21)
- PDE10A (20)
- PDE1B (20)
- POLR2J2 (20)
- NUDT9 (19)
- PDE1A (18)
- PKM (18)
- POLR2E (18)
- POLA2 (16)
- POLR3GL (14)
- RRM2 (14)
- GUK1 (13)
- POLR2J (13)
- XDH (13)
- NT5E (12)
- POLR3H (12)
- IMPDH2 (11)
- ZNRD1 (10)
- NME2 (9)
- PDE4D (9)
- CANT1 (8)
- ENPP3 (8)
- PDE3B (8)
- ADSL (7)
- GMPR (7)
- NPR1 (7)
- POLR3C (7)
- ADA (6)
- PRPS1L1 (6)
- PRPS2 (6)
- ADK (5)
- ENTPD2 (5)
- NPR2 (5)
- PDE7B (5)
- PDE9A (5)
- PNPT1 (5)
- POLR2F (5)
- POLR2G (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- AMPD2 (4)
- APRT (4)
- ENTPD3 (4)
- GMPS (4)
- GUCY1B1 (4)
- NT5C1A (4)
- PDE11A (4)
- PDE3A (4)
- POLD1 (4)
- POLE3 (4)
- POLR2B (4)
- POLR2I (4)
- POLR3A (4)
- POLR3F (4)
- PRPS1 (4)
- ADCY2 (3)
- ADCY6 (3)
- AK2 (3)
- AMPD1 (3)
- ENTPD5 (3)
- GDA (3)
- IMPDH1 (3)
- PDE1C (3)
- PDE4C (3)
- PDE5A (3)
- PDE7A (3)
- PDE8A (3)
- PDE8B (3)
- POLA1 (3)
- POLD3 (3)
- POLR1B (3)
- POLR2C (3)
- PRIM1 (3)
- PRUNE1 (3)
- RRM2B (3)
- ADCY3 (2)
- ADCY8 (2)
- ALLC (2)
- ENPP1 (2)
Reactivities
- Human (1401)
- Rat (1071)
- Mouse (1044)
- Monkey (95)
- Dog (74)
- Bovine (25)
- Chicken (8)
- Pig (8)
- Gibbon (6)
- Horse (6)
- Gorilla (5)
- X. tropicalis (5)
- Xenopus (5)
- Orang-Utan (4)
- Rabbit (4)
- Rhesus Monkey (4)
- Cow (3)
- Zebrafish (3)
- Bat (2)
- Drosophila (2)
- Hamster (2)
- Primate (2)
- Yeast (2)
- Canine (1)
- Chimpanzee (1)
- Frog (1)
- Fruit fly (1)
- Saccharomyces cerevisiae (1)
- Sheep (1)