Germany
Japan
United Kingdom
China
Products
Download
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
PTCH1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1) |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Active filters
Applications
- IHC
Pathways
- Pathways in cancer
Filter by
Target Symbol
- MAP2K1 (183)
- TP53 (149)
- ERBB2 (108)
- CDKN2A (91)
- CTNNB1 (83)
- AKT1 (73)
- NKX3-1 (73)
- BCL2 (68)
- JUN (67)
- EGFR (59)
- KIT (58)
- CDH1 (54)
- PIK3CG (54)
- MTOR (51)
- MDM2 (48)
- RET (48)
- FOS (42)
- GLI1 (40)
- KLK3 (38)
- PIK3R5 (37)
- BID (36)
- STAT5A (35)
- AR (32)
- MYC (32)
- MLH1 (31)
- BRAF (30)
- MAPK1 (29)
- MAPK9 (28)
- PIK3CD (28)
- HRAS (27)
- RB1 (27)
- MAPK8 (26)
- PTK2 (26)
- RELA (24)
- DAPK2 (23)
- HGF (23)
- MET (23)
- PIK3CA (23)
- BAX (22)
- CASP3 (22)
- FGFR2 (22)
- LAMB3 (22)
- WNT3 (22)
- CDKN1A (21)
- JUP (21)
- RALBP1 (20)
- FGF21 (19)
- FN1 (19)
- MAP2K2 (19)
- PTGS2 (19)
- ARNT (18)
- HDAC2 (18)
- BAD (17)
- BCL2L1 (17)
- CDKN2B (17)
- DVL2 (17)
- PDGFRA (17)
- PDGFRB (17)
- STAT1 (17)
- EGF (16)
- FH (16)
- FOXO1 (16)
- GSTP1 (16)
- IGF1 (16)
- KITLG (16)
- STAT3 (16)
- APC (15)
- COL4A1 (15)
- NFKBIA (15)
- CASP9 (14)
- MMP2 (14)
- MMP9 (14)
- MSH6 (14)
- RASSF1 (14)
- AKT2 (13)
- CHUK (13)
- HDAC1 (13)
- IKBKG (13)
- ABL1 (12)
- BIRC5 (12)
- CTBP2 (12)
- SMAD3 (12)
- VEGFB (12)
- AKT3 (11)
- ARAF (11)
- FGFR3 (11)
- GLI2 (11)
- HIF1A (11)
- HSP90AA1 (11)
- HSP90AB1 (11)
- IL6 (11)
- MSH2 (11)
- RAF1 (11)
- STAT5B (11)
- CSF1R (10)
- FGF2 (10)
- HSP90B1 (10)
- MITF (10)
- NTRK1 (10)
- PPARD (10)
Reactivities
- Human (3091)
- Mouse (2212)
- Rat (2095)
- Monkey (425)
- Dog (417)
- Bovine (55)
- Pig (31)
- Chicken (28)
- Rabbit (25)
- Primate (19)
- Hamster (17)
- Horse (17)
- Xenopus (15)
- Bat (14)
- Gorilla (13)
- Cow (11)
- Gibbon (10)
- Canine (7)
- Rhesus Monkey (7)
- Sheep (5)
- Zebrafish (5)
- Gerbil (4)
- X. tropicalis (4)
- Chimpanzee (3)
- Ferret (3)
- Guinea Pig (3)
- Porcine (3)
- Feline (2)
- Fish (2)
- Equine (1)
- Fungi (1)
- Goat (1)
- Insect (1)
- Orang-Utan (1)
- Plant (1)
- Quail (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (3413)
- ES Cell Differentiation/IPS (1042)
- Protein Kinase (1041)
- Transcription Factors (992)
- Transmembrane (796)
- Secreted Protein (443)
- Stem cell - Pluripotency (439)
- Adult stem cells (288)
- Embryonic stem cells (215)
- Stem cell relevant signaling - JAK/STAT signaling pathway (168)
- Cancer stem cells (166)
- Protease (139)
- Stem cell relevant signaling - DSL/Notch pathway (106)
- Stem cell relevant signaling - Wnt Signaling pathway (84)
- Induced pluripotent stem cells (73)
- Nuclear Hormone Receptor (63)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (59)
- GPCR (19)
- Phosphatase (8)