Germany
Japan
United Kingdom
China
Products
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
GFAP chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Recombinant Human GFAP (expressed in bacteria). After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks. |
EPCAM mouse monoclonal antibody, clone 323/A3, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
TAPA1 (CD81) mouse monoclonal antibody, clone M38, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Rabbit |
USD 220.00
2 Weeks
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Anti-HES1 mouse mAb, clone OTI4H1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 524.00
In Stock
Active filters
Applications
- WB
Families
- ES Cell Differentiation/IPS
Filter by
Target Symbol
- CD4 (202)
- JUN (173)
- EGFR (156)
- CTNNB1 (149)
- GLI1 (145)
- ABCB1 (124)
- PECAM1 (122)
- VIM (122)
- AKT1 (116)
- EPCAM (94)
- L1CAM (94)
- BCL2 (86)
- GFAP (74)
- KIT (74)
- PROCR (74)
- CD44 (72)
- FGF21 (71)
- MKI67 (70)
- NKX2-1 (69)
- STAT5A (69)
- NCAM1 (68)
- BSG (66)
- TNFRSF8 (66)
- PTPRC (65)
- FCGR2A (63)
- PIK3CG (63)
- KRT7 (61)
- CDH1 (58)
- CSF3 (57)
- GAPDH (57)
- PDGFRA (57)
- TNNI3 (55)
- MAPK8 (54)
- SMAD1 (54)
- GATA3 (53)
- CSF2 (49)
- TAL1 (48)
- LHX1 (47)
- NEUROG1 (46)
- VCAM1 (46)
- CASP3 (45)
- CPA1 (45)
- CD34 (44)
- ENPEP (44)
- CDH2 (42)
- KDR (42)
- SERPINA1 (42)
- HES1 (41)
- ICAM3 (41)
- PDGFRB (41)
- PDX1 (41)
- CDX2 (40)
- ID3 (40)
- AKT2 (39)
- CDCP1 (39)
- HNF4A (39)
- ACTB (38)
- ENG (36)
- IRF6 (35)
- DVL2 (34)
- MCAM (34)
- PTCH1 (34)
- SIGLEC7 (33)
- SMAD2 (33)
- IGFBP1 (32)
- PROM1 (32)
- GNL3 (31)
- MAPK9 (31)
- SPN (31)
- MAP2 (30)
- CD14 (29)
- SRC (29)
- CST3 (28)
- HOXD8 (27)
- IGF1 (27)
- PRKCA (26)
- SOX9 (26)
- BCL2L1 (25)
- BMP6 (25)
- CSF1 (25)
- ZFP42 (25)
- EGF (24)
- HGF (24)
- KLF5 (24)
- ICAM1 (23)
- MPI (23)
- NECTIN1 (23)
- SOX2 (23)
- DLX1 (22)
- MAPK3 (22)
- SMAD3 (22)
- YBX1 (22)
- ANGPT1 (21)
- ANPEP (21)
- FN1 (21)
- GLI2 (21)
- NEFL (21)
- GATA4 (20)
- LAMP1 (20)
- PLAU (20)
Reactivities
- Human (6208)
- Mouse (3629)
- Rat (3354)
- Dog (368)
- Monkey (357)
- Bovine (50)
- Pig (42)
- Chicken (38)
- Cow (32)
- Canine (25)
- Primate (20)
- Rabbit (20)
- Zebrafish (18)
- Xenopus (17)
- Feline (12)
- Porcine (10)
- Sheep (10)
- Drosophila (9)
- Hamster (9)
- Avian (7)
- Goat (5)
- X. tropicalis (5)
- Chimpanzee (4)
- Guinea Pig (3)
- Mammalian (3)
- Rhesus Monkey (3)
- Yeast (3)
- All Species (2)
- Bacteria (2)
- Insect (2)
- Macaque (2)
- Broad (1)
- C. elegans (1)
- Canis (1)
- Equine (1)
- Fish (1)
- Invertebrate (1)
- Opossum (1)
- Protozoa (1)
- Quail (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Pathways in cancer (2018)
- Focal adhesion (1317)
- Colorectal cancer (1186)
- Cell adhesion molecules (CAMs) (994)
- MAPK signaling pathway (967)
- ErbB signaling pathway (837)
- Prostate cancer (822)
- Cytokine-cytokine receptor interaction (808)
- T cell receptor signaling pathway (802)
- Hematopoietic cell lineage (744)
- Melanoma (742)
- Endometrial cancer (668)
- Regulation of actin cytoskeleton (649)
- Wnt signaling pathway (622)
- Pancreatic cancer (620)
- Neurotrophin signaling pathway (609)
- Glioma (588)
- Adherens junction (573)
- Leukocyte transendothelial migration (571)
- Toll-like receptor signaling pathway (544)
- Jak-STAT signaling pathway (535)
- GnRH signaling pathway (494)
- Epithelial cell signaling in Helicobacter pylori infection (488)
- Acute myeloid leukemia (486)
- Basal cell carcinoma (479)
- Renal cell carcinoma (477)
- Endocytosis (463)
- Non-small cell lung cancer (463)
- B cell receptor signaling pathway (442)
- Tight junction (439)
- Fc gamma R-mediated phagocytosis (429)
- Chronic myeloid leukemia (420)
- Fc epsilon RI signaling pathway (417)
- Apoptosis (408)
- Small cell lung cancer (401)
- Progesterone-mediated oocyte maturation (372)
- Gap junction (370)
- Melanogenesis (362)
- Insulin signaling pathway (355)
- VEGF signaling pathway (354)
- Pathogenic Escherichia coli infection (328)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (323)
- TGF-beta signaling pathway (323)
- Hedgehog signaling pathway (317)
- Chemokine signaling pathway (304)
- Calcium signaling pathway (296)
- mTOR signaling pathway (287)
- Primary immunodeficiency (284)
- Natural killer cell mediated cytotoxicity (282)
- Adipocytokine signaling pathway (272)
- Bladder cancer (260)
- Thyroid cancer (247)
- Antigen processing and presentation (237)
- Type II diabetes mellitus (221)
- Maturity onset diabetes of the young (216)
- Hypertrophic cardiomyopathy (HCM) (215)
- Dilated cardiomyopathy (199)
- Dorso-ventral axis formation (197)
- Amyotrophic lateral sclerosis (ALS) (177)
- ECM-receptor interaction (175)
- Metabolic pathways (169)
- Axon guidance (159)
- Alzheimer's disease (144)
- Notch signaling pathway (143)
- ABC transporters (129)
- Viral myocarditis (125)
- Prion diseases (117)
- NOD-like receptor signaling pathway (107)
- Systemic lupus erythematosus (107)
- RIG-I-like receptor signaling pathway (93)
- Phosphatidylinositol signaling system (89)
- p53 signaling pathway (89)
- Renin-angiotensin system (81)
- Long-term depression (75)
- Cell cycle (73)
- Glycolysis / Gluconeogenesis (67)
- Vibrio cholerae infection (64)
- Huntington's disease (63)
- Inositol phosphate metabolism (63)
- Complement and coagulation cascades (62)
- Cardiac muscle contraction (55)
- Autoimmune thyroid disease (52)
- Oocyte meiosis (52)
- Long-term potentiation (48)
- Vascular smooth muscle contraction (48)
- Allograft rejection (45)
- Parkinson's disease (45)
- Type I diabetes mellitus (37)
- Graft-versus-host disease (34)
- Nicotinate and nicotinamide metabolism (27)
- Lysosome (24)
- Amino sugar and nucleotide sugar metabolism (23)
- Fructose and mannose metabolism (23)
- Glutathione metabolism (21)
- Retinol metabolism (17)
- Ubiquitin mediated proteolysis (17)
- Neuroactive ligand-receptor interaction (13)
- Asthma (11)
- Purine metabolism (11)
- Pyrimidine metabolism (11)
- Tyrosine metabolism (11)
- Starch and sucrose metabolism (10)
- Drug metabolism - cytochrome P450 (8)
- Drug metabolism - other enzymes (8)
- Galactose metabolism (8)
- Linoleic acid metabolism (8)
- Metabolism of xenobiotics by cytochrome P450 (8)
- Cysteine and methionine metabolism (7)
- Phenylalanine (7)
- Phenylalanine metabolism (7)
- Ubiquinone and other terpenoid-quinone biosynthesis (7)
- tyrosine and tryptophan biosynthesis (7)
- Oxidative phosphorylation (4)
- PPAR signaling pathway (3)
- Regulation of autophagy (3)
- Citrate cycle (TCA cycle) (2)
- Pyruvate metabolism (2)
- Primary bile acid biosynthesis (1)