Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal Anti-Nectin-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)GKPPSVVSWETRLK, corresponding to amino acid residues 177- 190 of human nectin-1. Extracellular, N-terminus. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
SMAD3 mouse monoclonal antibody, clone AF9F7, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
beta Actin (ACTB) mouse monoclonal antibody, clone AC-15, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
alpha Actinin (ACTN1) mouse monoclonal antibody, clone SA-20, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Src (Tyr529) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Src around the phosphorylation site of tyrosine 529 (P-Q-YP-Q-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Anti-SRC (Phospho-Tyr529) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 529 (P-Q-Y(p)-Q-P) derived from Human Src. |
| Modifications | Phospho-specific |
EGFR L858R mouse monoclonal antibody,clone UMAB233
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 355.00
2 Weeks
EGFR (Ligand binding Site) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
EGFR (Ligand bdg. Dom.) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Rat |
Germany
Japan
United Kingdom
China
