Germany
Japan
United Kingdom
China
Primary Antibodies
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
MonoMethyl-Histone H3-K27 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 |
TriMethyl-Histone H3-K79 Rabbit Polyclonal Antibody
| Applications | ChIP, Dot, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K79 of human histone H3 |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal FOXP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal FOXP3 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human FOXP3. The immunogen is located within the last 50 amino acids of FOXP3. |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
Ku70 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 408-609 of human Ku70 (NP_001460.1). |
| Modifications | Unmodified |
USD 379.00
In Stock
USD 428.00
In Stock
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit Polyclonal H3K9me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-SMURF2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SMURF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human SMURF2. The immunogen is located within amino acids 140 - 190 of SMURF2. |
TAZ Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human TAZ (NP_056287.1). |
| Modifications | Unmodified |
TAZ Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human TAZ (NP_056287.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YAP1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
| Modifications | Unmodified |
YEATS4 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human YEATS4 (NP_006521.1). |
| Modifications | Unmodified |
YEATS4 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human YEATS4 (NP_006521.1). |
| Modifications | Unmodified |
Active filters
Reactivities
- Mouse
Applications
- WB
Filter by
Target Symbol
- VSNL1 (274)
- ALK (272)
- MAP2K1 (227)
- JUN (179)
- NME1 (158)
- ERCC1 (157)
- MAP2K3 (157)
- GLI1 (147)
- CTNNB1 (145)
- ERBB2 (142)
- EGFR (139)
- GADD45G (132)
- OTC (132)
- ABCB1 (127)
- VIM (125)
- AKT1 (118)
- NUMB (112)
- PIK3C2A (111)
- PCNA (109)
- APP (99)
- MAPK13 (99)
- TOP2A (98)
- UBE2E3 (96)
- BRAF (94)
- L1CAM (93)
- SENP2 (93)
- LGALS3 (90)
- TYMS (88)
- PNMT (87)
- BCL2 (81)
- MIEN1 (80)
- SQSTM1 (75)
- LOX (73)
- STAT5A (73)
- MAPK1 (72)
- MTOR (72)
- SPG7 (72)
- UBA52 (72)
- GFAP (71)
- MLH1 (71)
- NCAM1 (70)
- AFAP1 (69)
- ALDH1L1 (69)
- BCL10 (69)
- CNOT4 (69)
- NKX2-1 (69)
- SNAI2 (69)
- F13A1 (67)
- CDK2 (65)
- MAPT (65)
- STAT4 (65)
- NR3C1 (64)
- LGR5 (62)
- LPL (62)
- PIK3CG (62)
- PSMC3 (62)
- ABAT (61)
- BECN1 (61)
- MIOX (61)
- RB1 (61)
- SOCS3 (61)
- SYP (61)
- BBOX1 (60)
- PARVA (60)
- ZFP36 (60)
- LIMK1 (59)
- MAPK7 (59)
- NRBF2 (59)
- UNG (59)
- ACAT2 (58)
- BTK (58)
- KRAS (58)
- MEF2C (58)
- NPR3 (58)
- ARHGAP25 (57)
- CCM2 (57)
- IGF2BP2 (57)
- MOB3B (57)
- BAG5 (56)
- DPP9 (56)
- FOSB (56)
- FOXO1 (56)
- PSMA6 (56)
- PTPRE (56)
- TNNT2 (56)
- TTLL12 (56)
- CRYAB (55)
- LTA4H (55)
- MAPKAPK5 (55)
- MSI1 (55)
- NAB1 (55)
- PDGFRA (55)
- PIK3AP1 (55)
- SNAP25 (55)
- SNTA1 (55)
- TNNI3 (55)
- VBP1 (55)
- ZNF365 (55)
- CBX8 (54)
- KCNAB1 (54)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
- Unmodified (7651)
- Phospho-specific (1048)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (13)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (7)
- Acetyl K5 (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (4)
- Modification (3)
- Phospho S166 (3)
- Phospho S376 (3)
- Phospho S83 (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- Acetyl K16 (2)
- Acetyl K27 (2)
- Acetyl K36 (2)
- MonoMethyl K342 (2)
- Phospho S104 (2)
- Phospho S127 (2)
- Phospho S128 (2)
- Phospho S15 (2)
- Phospho S16 (2)
- Phospho S319 (2)
- Phospho S366 (2)
- Phospho S37 (2)
- Phospho S380 (2)
- Phospho S39 (2)
- Phospho S727 (2)
- Phospho S89 (2)
- Phospho T187 (2)
- Phospho T286 (2)
- Phospho T389 (2)
- Phospho T514 (2)
- Phospho Y410 (2)
- This chimeric hamster (Armenian) antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K29 (1)
- Acetyl K332 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho 180/Y182,Phospho T180/Y182,Phospho T180/Y182,Phospho T183/Y1845 (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S1033 (1)
- Phospho S1105 (1)
- Phospho S1108 (1)
- Phospho S112 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S129 (1)
- Phospho S1387 (1)
- Phospho S139 (1)
- Phospho S157 (1)
- Phospho S16/T17 (1)
- Phospho S17 (1)
- Phospho S172 (1)
- Phospho S176 (1)
- Phospho S176/180 (1)
- Phospho S180 (1)
- Phospho S182 (1)
- Phospho S189,Phospho S207 (1)
- Phospho S19 (1)
- Phospho S1943 (1)
- Phospho S1981 (1)
- Phospho S199/S204 (1)
- Phospho S20 (1)
- Phospho S2056 (1)
- Phospho S209 (1)
- Phospho S2152 (1)
- Phospho S217 (1)
- Phospho S235/236 (1)
- Phospho S240/244 (1)
- Phospho S241 (1)
- Phospho S243 (1)
- Phospho S2448 (1)
- Phospho S2481 (1)
- Phospho S253 (1)
- Phospho S257 (1)
- Phospho S257/T261 (1)
- Phospho S259 (1)
- Phospho S28 (1)
- Phospho S280 (1)
- Phospho S29/33/37/T41 (1)
- Phospho S291 (1)
- Phospho S293 (1)
- Phospho S294 (1)
- Phospho S298 (1)
- Phospho S299 (1)
- Phospho S304 (1)
- Phospho S307 (1)
- Phospho S308,Phospho S309,Phospho S305 (1)
- Phospho S32 (1)
- Phospho S323 (1)
- Phospho S33 (1)
- Phospho S33/S37/T41 (1)
- Phospho S330 (1)
- Phospho S334 (1)
- Phospho S338 (1)
- Phospho S345 (1)
- Phospho S36 (1)
- Phospho S365 (1)
- Phospho S380/T382/383 (1)
- Phospho S386 (1)
- Phospho S392 (1)
- Phospho S396 (1)
- Phospho S397 (1)
- Phospho S4/S8 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S448 (1)
- Phospho S45 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S465/S467 (1)
- Phospho S467 (1)
- Phospho S471/472 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S474 (1)
- Phospho S485 (1)
- Phospho S5 (1)
- Phospho S505 (1)
- Phospho S51 (1)
- Phospho S516 (1)
- Phospho S519/T522 (1)
- Phospho S529 (1)
- Phospho S552 (1)
- Phospho S563 (1)
- Phospho S588 (1)
- Phospho S612 (1)
- Phospho S616 (1)
- Phospho S62 (1)
- Phospho S637 (1)
- Phospho S638 (1)
- Phospho S641 (1)
- Phospho S643/676 (1)
- Phospho S645 (1)
- Phospho S660 (1)
- Phospho S668 (1)
- Phospho S7 (1)
- Phospho S73 (1)
- Phospho S744/748 (1)
- Phospho S795 (1)
- Phospho S80 (1)
- Phospho S807/811 (1)
- Phospho S845 (1)
- Phospho S886 (1)
- Phospho S896/S897 (1)
- Phospho S897 (1)
- Phospho S9 (1)
- Phospho S916 (1)
- Phospho S957 (1)
- Phospho Ser15 (1)
- Phospho Ser198/Ser199/Ser202 (1)
- Phospho Ser355 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho Ser792 (1)
- Phospho Ser90 (1)
- Phospho T11 (1)
- Phospho T117 (1)
- Phospho T14 (1)
- Phospho T1462 (1)
- Phospho T156 (1)
- Phospho T163 (1)
- Phospho T17 (1)
- Phospho T172 (1)
- Phospho T179 (1)
- Phospho T18 (1)
- Phospho T18/S19 (1)
- Phospho T180/T183 (1)
- Phospho T180/Y182 (1)
- Phospho T181 (1)
- Phospho T183/T172 (1)
- Phospho T183/Y185 (1)
- Phospho T186 (1)
- Phospho T189 (1)
- Phospho T197 (1)
- Phospho T197/202 (1)
- Phospho T1989 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T204 (1)
- Phospho T217 (1)
- Phospho T23 (1)
- Phospho T231 (1)
- Phospho T231/S232 (1)
- Phospho T232 (1)
- Phospho T235 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T246 (1)
- Phospho T261 (1)
- Phospho T3 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T334 (1)
- Phospho T346 (1)
- Phospho T357/S358/S360 (1)
- Phospho T37/46 (1)
- Phospho T384 (1)
- Phospho T387 (1)
- Phospho T395 (1)
- Phospho T410 (1)
- Phospho T421/S424 (1)
- Phospho T434 (1)
- Phospho T446 (1)
- Phospho T45 (1)
- Phospho T495 (1)
- Phospho T498 (1)
- Phospho T56 (1)
- Phospho T573 (1)
- Phospho T58 (1)
- Phospho T581 (1)
- Phospho T6 (1)
- Phospho T641 (1)
- Phospho T642 (1)
- Phospho T668 (1)
- Phospho T678 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T70 (1)
- Phospho T853 (1)
- Phospho T91 (1)
- Phospho T918 (1)
- Phospho T93 (1)
- Phospho T982 (1)
- Phospho Thr212/Ser214 (1)
- Phospho Thr421 (1)
- Phospho Y10 (1)
- Phospho Y1007 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1021 (1)
- Phospho Y1022/1023 (1)
- Phospho Y1054/1055 (1)
- Phospho Y1068 (1)
- Phospho Y1070 (1)
- Phospho Y1165/1166,Phospho Y1189/1190 (1)
- Phospho Y1175 (1)
- Phospho Y1189/Y1190,Phospho Y1165/Y1166 (1)
- Phospho Y1217 (1)
- Phospho Y1284 (1)
- Phospho Y133 (1)
- Phospho Y138 (1)
- Phospho Y139 (1)
- Phospho Y14 (1)
- Phospho Y145 (1)
- Phospho Y1474 (1)
- Phospho Y15 (1)
- Phospho Y165 (1)
- Phospho Y177 (1)
- Phospho Y182 (1)
- Phospho Y191 (1)
- Phospho Y204 (1)
- Phospho Y207 (1)
- Phospho Y221 (1)
- Phospho Y245 (1)
- Phospho Y307 (1)
- Phospho Y311 (1)
- Phospho Y322 (1)
- Phospho Y340 (1)
- Phospho Y397 (1)
- Phospho Y412 (1)
- Phospho Y416 (1)
- Phospho Y467/Y199/Y464 (1)
- Phospho Y564 (1)
- Phospho Y653 (1)
- Phospho Y659 (1)
- Phospho Y694 (1)
- Phospho Y705 (1)
- Phospho Y719 (1)
- Phospho Y724 (1)
- Phospho Y751 (1)
- Phospho Y771 (1)
- Phospho Y789 (1)
- Phospho Y792 (1)
- Phospho Y869 (1)
- Phospho Y980/981 (1)
- Phospho Y992 (1)
- Phospho pS221 (1)
- Phospho s724 (1)
- Phospho-PKC (pan) (βII Ser660) (1)
- Phospho-RPS6KB1-S371 (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This constant region of this antibody has been modified to bind to Protein A, allowing highly-specific purification of this antibody by Protein A-affinity column. (1)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Ubiquityl K119 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
- monoMethyl E105 (1)
- pan Phospho-Serine/Threonine (1)
- pan Symmetric-DiMethyl-Arginine (1)
- phospho S76 (1)
- succinylation K79 (1)
Assay Types
Families
- Druggable Genome (30395)
- Transcription Factors (9405)
- Transmembrane (6919)
- Protein Kinase (4648)
- ES Cell Differentiation/IPS (3629)
- Secreted Protein (2439)
- Stem cell - Pluripotency (2269)
- Protease (2058)
- Adult stem cells (865)
- Nuclear Hormone Receptor (796)
- Phosphatase (687)
- Embryonic stem cells (641)
- Cancer stem cells (565)
- GPCR (495)
- Stem cell relevant signaling - JAK/STAT signaling pathway (453)
- Stem cell relevant signaling - DSL/Notch pathway (358)
- Induced pluripotent stem cells (305)
- Ion Channels: Other (300)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (227)
- Ion Channels: Potassium (124)
- P450 (122)
- Stem cell relevant signaling - Wnt Signaling pathway (105)
- Ion Channels: Cys-loop Receptors (74)
- Ion Channels: Glutamate Receptors (51)
- Ion Channels: Transient receptor potential (47)
- Ion Channels: Sodium (10)
- Ion Channels: Cyclic nucleotide gated (9)
- Ion Channels: ATP Receptors (6)
- Ion Channels: Calcium (5)
Pathways
- Metabolic pathways (4999)
- Pathways in cancer (4456)
- MAPK signaling pathway (3296)
- Focal adhesion (2643)
- Prostate cancer (2191)
- Neurotrophin signaling pathway (2143)
- Colorectal cancer (2053)
- ErbB signaling pathway (1990)
- Regulation of actin cytoskeleton (1811)
- Insulin signaling pathway (1772)
- T cell receptor signaling pathway (1704)
- Pancreatic cancer (1672)
- Toll-like receptor signaling pathway (1585)
- Progesterone-mediated oocyte maturation (1578)
- Endometrial cancer (1554)
- Chronic myeloid leukemia (1546)
- B cell receptor signaling pathway (1536)
- GnRH signaling pathway (1480)
- Melanoma (1474)
- Chemokine signaling pathway (1472)
- Glioma (1467)
- Non-small cell lung cancer (1465)
- Renal cell carcinoma (1419)
- Fc epsilon RI signaling pathway (1415)
- Acute myeloid leukemia (1411)
- Cell cycle (1368)
- Wnt signaling pathway (1272)
- VEGF signaling pathway (1242)
- Endocytosis (1220)
- Bladder cancer (1163)
- Leukocyte transendothelial migration (1127)
- Fc gamma R-mediated phagocytosis (1102)
- Gap junction (1102)
- Small cell lung cancer (1080)
- Adherens junction (1070)
- Natural killer cell mediated cytotoxicity (1066)
- Alzheimer's disease (1035)
- Purine metabolism (983)
- Epithelial cell signaling in Helicobacter pylori infection (973)
- Oocyte meiosis (969)
- Apoptosis (942)
- Jak-STAT signaling pathway (923)
- Melanogenesis (911)
- Axon guidance (902)
- Tight junction (900)
- mTOR signaling pathway (872)
- Calcium signaling pathway (867)
- Ubiquitin mediated proteolysis (859)
- Long-term potentiation (836)
- Adipocytokine signaling pathway (809)
- Cytokine-cytokine receptor interaction (803)
- Thyroid cancer (801)
- Huntington's disease (799)
- Amyotrophic lateral sclerosis (ALS) (790)
- Long-term depression (784)
- Vascular smooth muscle contraction (747)
- Pyrimidine metabolism (718)
- Type II diabetes mellitus (703)
- p53 signaling pathway (686)
- TGF-beta signaling pathway (664)
- Pathogenic Escherichia coli infection (646)
- Glycolysis / Gluconeogenesis (626)
- Neuroactive ligand-receptor interaction (594)
- Basal cell carcinoma (588)
- Nucleotide excision repair (579)
- Parkinson's disease (573)
- NOD-like receptor signaling pathway (567)
- Dorso-ventral axis formation (546)
- Hedgehog signaling pathway (545)
- Arginine and proline metabolism (538)
- Cell adhesion molecules (CAMs) (535)
- Prion diseases (532)
- RIG-I-like receptor signaling pathway (464)
- Proteasome (458)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (437)
- Hypertrophic cardiomyopathy (HCM) (431)
- Spliceosome (413)
- Phosphatidylinositol signaling system (412)
- Oxidative phosphorylation (406)
- Dilated cardiomyopathy (404)
- Valine (404)
- RNA degradation (395)
- leucine and isoleucine degradation (385)
- Notch signaling pathway (383)
- Inositol phosphate metabolism (375)
- Pyruvate metabolism (337)
- DNA replication (334)
- Alanine (330)
- aspartate and glutamate metabolism (330)
- Tyrosine metabolism (321)
- Base excision repair (320)
- Mismatch repair (317)
- Antigen processing and presentation (313)
- Vibrio cholerae infection (310)
- Fatty acid metabolism (299)
- Butanoate metabolism (292)
- PPAR signaling pathway (291)
- Lysine degradation (283)
- Primary immunodeficiency (274)
- Propanoate metabolism (266)
- One carbon pool by folate (264)
- Viral myocarditis (248)
- Glycine (241)
- serine and threonine metabolism (241)
- ABC transporters (240)
- Maturity onset diabetes of the young (237)
- Glutathione metabolism (233)
- Cardiac muscle contraction (228)
- Tryptophan metabolism (220)
- Arachidonic acid metabolism (213)
- Citrate cycle (TCA cycle) (199)
- Histidine metabolism (199)
- Lysosome (195)
- Cytosolic DNA-sensing pathway (194)
- Hematopoietic cell lineage (194)
- SNARE interactions in vesicular transport (194)
- Ribosome (190)
- Systemic lupus erythematosus (189)
- beta-Alanine metabolism (189)
- Glycerolipid metabolism (188)
- Cysteine and methionine metabolism (180)
- Amino sugar and nucleotide sugar metabolism (176)
- Drug metabolism - cytochrome P450 (176)
- Fructose and mannose metabolism (173)
- Complement and coagulation cascades (171)
- Pentose phosphate pathway (166)
- ECM-receptor interaction (164)
- Starch and sucrose metabolism (164)
- Porphyrin and chlorophyll metabolism (162)
- Regulation of autophagy (156)
- Drug metabolism - other enzymes (151)
- Metabolism of xenobiotics by cytochrome P450 (149)
- Circadian rhythm - mammal (145)
- Retinol metabolism (145)
- Terpenoid backbone biosynthesis (133)
- RNA polymerase (127)
- Methane metabolism (120)
- Type I diabetes mellitus (119)
- Fatty acid elongation in mitochondria (117)
- Renin-angiotensin system (112)
- Galactose metabolism (110)
- Glyoxylate and dicarboxylate metabolism (101)
- Nicotinate and nicotinamide metabolism (100)
- Basal transcription factors (99)
- Olfactory transduction (98)
- N-Glycan biosynthesis (97)
- Homologous recombination (95)
- Ascorbate and aldarate metabolism (94)
- Nitrogen metabolism (94)
- Glycerophospholipid metabolism (91)
- Selenoamino acid metabolism (89)
- Phenylalanine metabolism (88)
- Synthesis and degradation of ketone bodies (76)
- Androgen and estrogen metabolism (73)
- Folate biosynthesis (72)
- Ether lipid metabolism (70)
- Sphingolipid metabolism (64)
- Non-homologous end-joining (53)
- Primary bile acid biosynthesis (53)
- Taste transduction (51)
- Sulfur metabolism (50)
- Pantothenate and CoA biosynthesis (46)
- Aminoacyl-tRNA biosynthesis (43)
- Other glycan degradation (43)
- Riboflavin metabolism (43)
- Autoimmune thyroid disease (40)
- Caffeine metabolism (40)
- Graft-versus-host disease (40)
- Allograft rejection (39)
- Taurine and hypotaurine metabolism (37)
- Vitamin B6 metabolism (36)
- Glycosaminoglycan degradation (34)
- Thiamine metabolism (33)
- Limonene and pinene degradation (32)
- Cyanoamino acid metabolism (31)
- Fatty acid biosynthesis (30)
- Glycosphingolipid biosynthesis - lacto and neolacto series (30)
- Keratan sulfate biosynthesis (30)
- leucine and isoleucine biosynthesis (27)
- Linoleic acid metabolism (26)
- Biosynthesis of unsaturated fatty acids (25)
- Pentose and glucuronate interconversions (24)
- O-Glycan biosynthesis (22)
- Phenylalanine (22)
- tyrosine and tryptophan biosynthesis (22)
- D-Glutamine and D-glutamate metabolism (19)
- alpha-Linolenic acid metabolism (19)
- Steroid biosynthesis (17)
- Asthma (14)
- Protein export (13)
- Glycosphingolipid biosynthesis - ganglio series (11)
- Heparan sulfate biosynthesis (6)
- Ubiquinone and other terpenoid-quinone biosynthesis (6)
- C21-Steroid hormone metabolism (5)
- Chondroitin sulfate biosynthesis (4)
- Glycosphingolipid biosynthesis - globo series (3)
- Lysine biosynthesis (3)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- D-Arginine and D-ornithine metabolism (1)
- Lipoic acid metabolism (1)
- O-Mannosyl glycan biosynthesis (1)