Rabbit Polyclonal Ogg1 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human Ogg1 (within amino acids 1-100). |
Rabbit Polyclonal Ogg1 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human Ogg1 (within amino acids 1-100). |
POLB Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLB |
Mouse monoclonal anti-PARP antibody, clone 7A10
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LIG1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIG1 |
Rabbit anti-PARP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PARP1 |
Rabbit Polyclonal Anti-HMGB1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1. |
Goat Polyclonal Anti-PCNA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1. |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit anti-APEX1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human APEX1 |
Rabbit anti-MPG Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MPG |
Rabbit Polyclonal MBD4 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MBD4 antibody: human MBD4 (Methyl-CpG-binding domain protein 4), using three different KLH-conjugated synthetic peptides. |
LIG3 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIG3 |
Rabbit polyclonal anti-PCNA antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PCNA |
Goat Polyclonal Anti-MUTYH Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 476 aa to the C-terminus of human Mutyh produced in E. coli. |
Rabbit Polyclonal PCNA Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
HMG1 (HMGB1) mouse monoclonal antibody, clone J2E1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
PARP2 mouse monoclonal antibody, clone AT29G4, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Rabbit Polyclonal Antibody against APE1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein. |
Rabbit polyclonal antibody to DNA ligase 3 (ligase III, DNA, ATP-dependent)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 116 and 433 of DNA ligase 3 (Uniprot ID#P49916) |
Rabbit Polyclonal NTH1 Antibody
Applications | WB |
Reactivities | Bovine, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human NTH1 conjugated to KLH. |
Rabbit Polyclonal Anti-MUTYH Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MUTYH Antibody: A synthesized peptide derived from human MUTYH |
PARP2 mouse monoclonal antibody, clone AT29G4, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
PARP2 (389-401) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from an internal region of human PARP2 |
NEI3 (NEIL3) (164-177) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from human NEIL3 |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Goat Polyclonal Antibody against SMUG1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQAFLLGSIHEPA-C, from the N Terminus of the protein sequence according to NP_055126. |
Rabbit polyclonal anti-HMGB1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HMGB1. |
Rabbit polyclonal anti-PCNA antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PCNA. |
Rabbit polyclonal anti-FEN1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FEN1. |
Rabbit polyclonal anti-XRCC1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human XRCC1. |
Rabbit polyclonal anti-SMUG1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SMUG1. |
Rabbit polyclonal PCNA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit polyclonal XRCC1 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This XRCC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 407-435 amino acids from the Central region of human XRCC1. |
Rabbit Polyclonal Cleaved-PARP antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PARP |
Rabbit polyclonal Patched antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Patched. |
Rabbit anti-HMGB1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human HMGB1 |
Rabbit anti-TDG Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TDG |
Rabbit Polyclonal Anti-POLE3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLE3 antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSC |
Rabbit Polyclonal Anti-POLE4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLE4 antibody: synthetic peptide directed towards the N terminal of human POLE4. Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV |
Rabbit Polyclonal Anti-POLD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT |
Rabbit Polyclonal Anti-PCNA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA |
Rabbit Polyclonal Anti-XRCC1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XRCC1 Antibody: A synthesized peptide derived from human XRCC1 |
HMG1 (HMGB1) mouse monoclonal antibody, clone J2E1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
PCNA mouse monoclonal antibody, clone IML-83, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
DNA Ligase I (LIG1) mouse monoclonal antibody, clone 10G12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
MYH (MUTYH) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
APE1 (APEX1) (2-15) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from N Terminus of APE1 / APEX1 - KLH conjugated |
MYH (MUTYH) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 352-381aa) of human MUTYH. |
Mouse Monoclonal Antibody against APEX1 (13B8E5C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against PARP2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LDLFEVEKDGEKE, from the internal region of the protein sequence according to NP_005475.1. |