Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit anti-PROC Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PROC |
Rabbit anti-SERPING1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPING1 |
USD 379.00
In Stock
Complement C4A (C4A) mouse monoclonal antibody, clone 10-12, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
USD 590.00
5 Days
Complement factor B (CFB) (Bb Fragment) mouse monoclonal antibody, clone 10-09, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
USD 745.00
5 Days
Complement C3 (C3) (Neoantigen, iC3b) mouse monoclonal antibody, clone 013III-1.16, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
Factor H (CFH) mouse monoclonal antibody, clone OX-24, Purified
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Human |
Thrombomodulin (THBD) mouse monoclonal antibody, clone B-A35, Azide Free
| Applications | ELISA |
| Reactivities | Human |
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
Complement C3 (C3) goat polyclonal antibody, TRITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | TRITC |
| Immunogen | C3c is isolated and purified from pooled normal human serum. Freund’s complete adjuvant is used in the first step of the immunization. |
Complement C5 (C5) goat polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | C5 protein isolated and purified from pooled normal human serum. Freund’s complete adjuvant is used in the first step of the immunization |
C1QA rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | The subunit C1q is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Complement C3 (C3) chicken polyclonal antibody, HRP
| Applications | ELISA, FC, WB |
| Reactivities | Human |
| Conjugation | HRP |
| Immunogen | Purified Human Complement Component 3a (C3a) peptide. |
Factor I (CFI) mouse monoclonal antibody, clone OX-21, Biotin
| Applications | ELISA, FC, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Factor I (CFI) mouse monoclonal antibody, clone OX-21, FITC
| Applications | ELISA, FC, IP, R, WB |
| Reactivities | Human |
| Conjugation | FITC |
Rabbit polyclonal antibody to Factor XIIIa (coagulation factor XIII, A1 polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 258 of Factor XIIIa (Uniprot ID#P00488) |
Factor VIII Sheep Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | F8 / FVIII / Factor VIII antibody was raised against human Factor VIIIC (F. VIII) purified from F. VIII concentrate. |
B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%). |
Anti-FGB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 290 amino acids of human fibrinogen beta chain |
Rabbit polyclonal C1QC Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC. |
Rabbit polyclonal SERPINE1 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SERPINE1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-216 amino acids from the Central region of human SERPINE1. |
Rabbit polyclonal C1QB Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This C1QB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 55-81 amino acids from the N-terminal region of human C1QB. |
Rabbit anti-F9 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F9 |
Rabbit anti-KLKB1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KLKB1 |
Rabbit anti-SERPIND1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPIND1 |
Rabbit Polyclonal Anti-SERPIND1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPIND1 antibody: synthetic peptide directed towards the middle region of human SERPIND1. Synthetic peptide located within the following region: VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ |
Rabbit Polyclonal Anti-C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ |
Rabbit Polyclonal Anti-C8G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C8G antibody is: synthetic peptide directed towards the N-terminal region of Human C8G. Synthetic peptide located within the following region: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD |
Rabbit Polyclonal Anti-F13B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F13B antibody: synthetic peptide directed towards the middle region of human F13B. Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP |
Goat Polyclonal Anti-fibrinogen alpha chain (aa123-135) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-fibrinogen alpha chain (aa123-135) Antibody: Peptide with sequence C-RDNTYNRVSEDLR, from the internal region of the protein sequence according to NP_000499.1; NP_068657.1. |
Rabbit Polyclonal Von Willebrand Factor Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 745.00
5 Days
Complement C3 (C3) mouse monoclonal antibody, clone 053A-514.3.1.4, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
USD 745.00
5 Days
Complement factor B (CFB) (Bb Fragment) mouse monoclonal antibody, clone 032B-22.1.X, Purified
| Applications | ELISA, FC, WB |
| Reactivities | Human |
C5R1 (C5AR1) mouse monoclonal antibody, clone 3H1738, Purified
| Applications | FC, FN, IHC, NEUT |
| Reactivities | Human, Rabbit |
Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AD-1, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Active filters
Category
- Antibodies
Pathways
- Complement and coagulation cascades
Filter by
Target Symbol
- CFI (112)
- VWF (106)
- F13A1 (98)
- FGG (62)
- CR2 (57)
- SERPINA5 (50)
- SERPINA1 (48)
- TFPI (40)
- C1S (33)
- MASP2 (29)
- F10 (25)
- C3 (23)
- C6 (23)
- PLAU (22)
- C2 (21)
- F12 (21)
- F13B (17)
- F2 (17)
- PLG (17)
- F7 (16)
- C1R (15)
- F2R (14)
- SERPINC1 (14)
- CD59 (13)
- CFB (13)
- C5 (11)
- CD46 (11)
- CR1 (11)
- KNG1 (11)
- MBL2 (11)
- SERPING1 (11)
- C4A (10)
- CD55 (10)
- CFH (10)
- F8 (10)
- F9 (10)
- FGB (10)
- PLAT (10)
- C5AR1 (9)
- SERPINE1 (9)
- A2M (8)
- CPB2 (8)
- PROC (8)
- THBD (8)
- BDKRB1 (7)
- C4B (7)
- FGA (7)
- PROS1 (7)
- C1QA (6)
- KLKB1 (6)
- SERPINF2 (6)
- C9 (5)
- BDKRB2 (4)
- C1QB (4)
- F11 (4)
- PLAUR (4)
- C1QC (3)
- C3AR1 (3)
- C7 (3)
- CFD (3)
- SERPIND1 (3)
- C4BPA (2)
- C8B (2)
- F3 (2)
- MASP1 (2)
- C4BPB (1)
- C8G (1)