Primary Antibodies

View as table Download

Rabbit Polyclonal Ogg1 Antibody

Applications IHC, WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the human Ogg1 (within amino acids 1-100).

POLB Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human POLB

Mouse monoclonal anti-PARP antibody, clone 7A10

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

LIG1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human LIG1

Rabbit anti-PARP1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PARP1

Rabbit Polyclonal Anti-HMGB1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1.

Goat Polyclonal Anti-PCNA Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCNA Antibody: Peptide with sequence C-NGNIKLSQTSNVD, from the internal region of the protein sequence according to NP_002583.1.

Rabbit anti-POLD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human POLD1

Rabbit anti-APEX1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human APEX1

Rabbit anti-MPG Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MPG

Rabbit Polyclonal MBD4 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: human MBD4 (Methyl-CpG-binding domain protein 4), using three different KLH-conjugated synthetic peptides.

LIG3 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LIG3

Rabbit polyclonal anti-PCNA antibody, Loading control

Applications WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human PCNA

USD 300.00

In Stock

Goat Polyclonal Anti-MUTYH Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 476 aa to the C-terminus of human Mutyh produced in E. coli.

Rabbit Polyclonal PCNA Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

PARP2 mouse monoclonal antibody, clone AT29G4, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

Rabbit Polyclonal Antibody against APE1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein.

Rabbit polyclonal antibody to DNA ligase 3 (ligase III, DNA, ATP-dependent)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 116 and 433 of DNA ligase 3 (Uniprot ID#P49916)

Rabbit Polyclonal NTH1 Antibody

Applications WB
Reactivities Bovine, Human, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the human NTH1 conjugated to KLH.

HMG1 / HMGB1 Mouse Monoclonal (IMG19N10B7) Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-MUTYH Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MUTYH Antibody: A synthesized peptide derived from human MUTYH

PARP2 mouse monoclonal antibody, clone AT29G4, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

PARP2 (389-401) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human PARP2

NEI3 (NEIL3) (164-177) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from human NEIL3

Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker

Applications IHC, WB
Reactivities Human, Mouse, Dog, Bovine, Hamster, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429]

Goat Polyclonal Antibody against SMUG1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PQAFLLGSIHEPA-C, from the N Terminus of the protein sequence according to NP_055126.

Rabbit polyclonal anti-HMGB1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HMGB1.

Rabbit polyclonal anti-PCNA antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PCNA.

Rabbit polyclonal anti-FEN1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FEN1.

Rabbit polyclonal anti-XRCC1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human XRCC1.

Rabbit polyclonal anti-SMUG1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SMUG1.

Rabbit polyclonal PCNA Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA.

Rabbit polyclonal XRCC1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This XRCC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 407-435 amino acids from the Central region of human XRCC1.

Rabbit Polyclonal Cleaved-PARP antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PARP

Rabbit polyclonal Patched antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Patched.

Rabbit anti-HMGB1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human HMGB1

Rabbit anti-TDG Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TDG

Rabbit Polyclonal Anti-POLE3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLE3 antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSC

Rabbit Polyclonal Anti-POLE4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLE4 antibody: synthetic peptide directed towards the N terminal of human POLE4. Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV

Rabbit Polyclonal Anti-POLD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT

Rabbit Polyclonal Anti-PCNA Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA

Rabbit Polyclonal Anti-XRCC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-XRCC1 Antibody: A synthesized peptide derived from human XRCC1

PCNA mouse monoclonal antibody, clone IML-83, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

MYH (MUTYH) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

APE1 (APEX1) (2-15) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from N Terminus of APE1 / APEX1 - KLH conjugated

MYH (MUTYH) (Center) rabbit polyclonal antibody, Purified

Applications FC, IF, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 352-381aa) of human MUTYH.

Mouse Monoclonal Antibody against APEX1 (13B8E5C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated