Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit anti-TFAM Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFAM |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit Polyclonal Anti-RCOR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Glutathione Peroxidase 1 (GPX1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 164-193aa) of human Glutathione peroxidase 1 / GPX1. |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit polyclonal antibody to dynactin 1 (dynactin 1 (p150, glued homolog, Drosophila))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1216 and 1278 of DCTN1 (Uniprot ID#Q14203) |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit anti-TGM2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TGM2 |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
Cytochrome C (CYCS) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Cytochrome C |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Pathways
- Huntington's disease
Filter by
Category
Target Symbol
- TP53 (22)
- CASP3 (14)
- CASP9 (14)
- CREB1 (13)
- HDAC2 (13)
- BAX (10)
- GRIN1 (10)
- APAF1 (9)
- HDAC1 (9)
- BDNF (7)
- COX4I1 (6)
- TGM2 (6)
- CASP8 (5)
- CREBBP (5)
- EP300 (5)
- PPARG (5)
- VDAC1 (5)
- ATP5PF (4)
- COX6B1 (4)
- CYCS (4)
- GRM5 (4)
- NDUFA10 (4)
- PLCB3 (4)
- SOD2 (4)
- SP1 (4)
- TFAM (4)
- BBC3 (3)
- DCTN2 (3)
- NDUFA8 (3)
- NDUFB9 (3)
- NDUFS1 (3)
- NDUFS2 (3)
- NDUFS4 (3)
- NDUFS8 (3)
- SDHA (3)
- SLC25A4 (3)
- SOD1 (3)
- AP2M1 (2)
- ATP5F1A (2)
- ATP5F1D (2)
- COX5A (2)
- COX5B (2)
- COX7B (2)
- COX7B2 (2)
- DCTN1 (2)
- DLG4 (2)
- GPX1 (2)
- GRIN2B (2)
- NDUFA5 (2)
- NDUFA9 (2)
- NDUFAB1 (2)
- NDUFC2 (2)
- NDUFS5 (2)
- NDUFS6 (2)
- NDUFV2 (2)
- NRF1 (2)
- PPARGC1A (2)
- RCOR1 (2)
- SDHB (2)
- SDHD (2)
- TBPL2 (2)
- UCP1 (2)
- VDAC2 (2)
- AP2A1 (1)
- AP2A2 (1)
- AP2B1 (1)
- AP2S1 (1)
- ATP5F1B (1)
- ATP5F1C (1)
- ATP5MC2 (1)
- ATP5MC3 (1)
- ATP5PD (1)
- CLTC (1)
- COX6A1 (1)
- COX6A2 (1)
- COX6B2 (1)
- COX7A2 (1)
- COX7A2L (1)
- COX8A (1)
- CREB3L1 (1)
- CREB3L2 (1)
- DCTN4 (1)
- DNAL1 (1)
- HAP1 (1)
- HTT (1)
- ITPR1 (1)
- LCMT2 (1)
- NDUFA1 (1)
- NDUFA2 (1)
- NDUFA3 (1)
- NDUFA4 (1)
- NDUFB1 (1)
- NDUFB10 (1)
- NDUFB5 (1)
- NDUFS3 (1)
- NDUFS7 (1)
- NDUFV1 (1)
- NDUFV3 (1)
- PLCB1 (1)
- PLCB2 (1)
Reactivities
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (225)
- Transcription Factors (94)
- Stem cell - Pluripotency (62)
- Transmembrane (60)
- Protease (35)
- ES Cell Differentiation/IPS (25)
- Adult stem cells (16)
- Ion Channels: Glutamate Receptors (12)
- Stem cell relevant signaling - DSL/Notch pathway (9)
- Ion Channels: Other (8)
- Embryonic stem cells (7)
- Induced pluripotent stem cells (7)
- Secreted Protein (7)
- Nuclear Hormone Receptor (5)
- GPCR (4)
- Stem cell relevant signaling - JAK/STAT signaling pathway (4)
- Ion Channels: Transient receptor potential (1)