Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
XRCC2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human XRCC2 |
Rabbit Polyclonal Anti-TSG101 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Active filters
Category
- Antibodies
Reactivities
- Rat
Applications
- WB
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Citations
- Yes
Filter by
Target Symbol
- PPARGC1A (3)
- RAC1 (3)
- ABCG2 (2)
- ADH5 (2)
- AOX1 (2)
- BAG3 (2)
- BAX (2)
- BDNF (2)
- BRAF (2)
- CCNA2 (2)
- GAD1 (2)
- HMOX1 (2)
- IRS1 (2)
- KDR (2)
- MAP3K5 (2)
- MAPK8 (2)
- RELA (2)
- SIGMAR1 (2)
- STAT5A (2)
- VCL (2)
- ABCC4 (1)
- ABCC5 (1)
- ABCD2 (1)
- ABCD3 (1)
- ADAM10 (1)
- ADAM17 (1)
- ADAMTS5 (1)
- ADCY1 (1)
- AGL (1)
- AHCY (1)
- AKAP12 (1)
- ANPEP (1)
- ANTXR1 (1)
- APP (1)
- AQP4 (1)
- ASAH1 (1)
- ATG5 (1)
- AURKB (1)
- BID (1)
- BRCA2 (1)
- CANX (1)
- CASP3 (1)
- CASP8 (1)
- CASP9 (1)
- CAV1 (1)
- CCNE1 (1)
- CD274 (1)
- CD276 (1)
- CD4 (1)
- CD44 (1)
- CDH2 (1)
- CDK6 (1)
- CDKN1A (1)
- CDKN2B (1)
- CHRM1 (1)
- COL1A1 (1)
- CRK (1)
- CTNNB1 (1)
- CX3CR1 (1)
- CYP19A1 (1)
- CYP24A1 (1)
- CYP3A4 (1)
- DCN (1)
- DDR1 (1)
- DUSP1 (1)
- EXT1 (1)
- FADD (1)
- FAP (1)
- FBXO17 (1)
- FGFR4 (1)
- FLCN (1)
- FOXO1 (1)
- FZD2 (1)
- GAB2 (1)
- GCH1 (1)
- GHRH (1)
- GNA15 (1)
- GP9 (1)
- GPD2 (1)
- GPER1 (1)
- GRIA1 (1)
- GRIN2B (1)
- GRM2 (1)
- GZMB (1)
- HDAC9 (1)
- HMMR (1)
- HNF4A (1)
- HSP90AA1 (1)
- IL12A (1)
- IL18 (1)
- IL1B (1)
- IL1R1 (1)
- IRF3 (1)
- ITGA4 (1)
- JAK1 (1)
- JAK2 (1)
- JMJD6 (1)
- KCNH2 (1)
- KLK5 (1)
- KLK7 (1)
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (48)
- Focal adhesion (29)
- MAPK signaling pathway (28)
- Metabolic pathways (22)
- Neurotrophin signaling pathway (22)
- Chemokine signaling pathway (21)
- Pancreatic cancer (21)
- Regulation of actin cytoskeleton (21)
- Colorectal cancer (20)
- Toll-like receptor signaling pathway (18)
- Insulin signaling pathway (16)
- Natural killer cell mediated cytotoxicity (16)
- Chronic myeloid leukemia (15)
- ErbB signaling pathway (15)
- Huntington's disease (15)
- Apoptosis (14)
- Prostate cancer (14)
- Renal cell carcinoma (14)
- Adipocytokine signaling pathway (13)
- Alzheimer's disease (13)
- Amyotrophic lateral sclerosis (ALS) (13)
- Axon guidance (13)
- Leukocyte transendothelial migration (13)
- Small cell lung cancer (13)
- Wnt signaling pathway (13)
- Adherens junction (12)
- Cytokine-cytokine receptor interaction (12)
- Acute myeloid leukemia (11)
- Epithelial cell signaling in Helicobacter pylori infection (11)
- Fc gamma R-mediated phagocytosis (11)
- Neuroactive ligand-receptor interaction (11)
- VEGF signaling pathway (11)
- p53 signaling pathway (11)
- B cell receptor signaling pathway (10)
- Fc epsilon RI signaling pathway (10)
- Jak-STAT signaling pathway (10)
- NOD-like receptor signaling pathway (10)
- Progesterone-mediated oocyte maturation (10)
- RIG-I-like receptor signaling pathway (10)
- T cell receptor signaling pathway (10)
- TGF-beta signaling pathway (9)
- Viral myocarditis (9)
- Calcium signaling pathway (8)
- Cell cycle (8)
- ECM-receptor interaction (8)
- Endometrial cancer (8)
- Glioma (8)
- Type II diabetes mellitus (8)
- Vascular smooth muscle contraction (8)
- Bladder cancer (7)
- Cell adhesion molecules (CAMs) (7)
- Endocytosis (7)
- Hematopoietic cell lineage (7)
- Melanoma (7)
- ABC transporters (6)
- Drug metabolism - cytochrome P450 (6)
- GnRH signaling pathway (6)
- Long-term potentiation (6)
- Non-small cell lung cancer (6)
- Pathogenic Escherichia coli infection (6)
- mTOR signaling pathway (6)
- Cytosolic DNA-sensing pathway (5)
- Gap junction (5)
- Long-term depression (5)
- Prion diseases (5)
- Thyroid cancer (5)
- Type I diabetes mellitus (5)
- Glycolysis / Gluconeogenesis (4)
- Melanogenesis (4)
- Metabolism of xenobiotics by cytochrome P450 (4)
- Parkinson's disease (4)
- Retinol metabolism (4)
- Tight junction (4)
- Tyrosine metabolism (4)
- Antigen processing and presentation (3)
- Arginine and proline metabolism (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Homologous recombination (3)
- Oocyte meiosis (3)
- Porphyrin and chlorophyll metabolism (3)
- Valine (3)
- leucine and isoleucine degradation (3)
- Alanine (2)
- Allograft rejection (2)
- Androgen and estrogen metabolism (2)
- Basal cell carcinoma (2)
- Base excision repair (2)
- Butanoate metabolism (2)
- Complement and coagulation cascades (2)
- Dilated cardiomyopathy (2)
- Dorso-ventral axis formation (2)
- Drug metabolism - other enzymes (2)
- Fatty acid metabolism (2)
- Fructose and mannose metabolism (2)
- Graft-versus-host disease (2)
- Lysosome (2)
- Maturity onset diabetes of the young (2)
- Methane metabolism (2)
- Mismatch repair (2)
- Nicotinate and nicotinamide metabolism (2)
- Notch signaling pathway (2)
- Phosphatidylinositol signaling system (2)
- Purine metabolism (2)
- Regulation of autophagy (2)
- Starch and sucrose metabolism (2)
- Taurine and hypotaurine metabolism (2)
- Tryptophan metabolism (2)
- Vitamin B6 metabolism (2)
- aspartate and glutamate metabolism (2)
- beta-Alanine metabolism (2)
- Ascorbate and aldarate metabolism (1)
- Autoimmune thyroid disease (1)
- Citrate cycle (TCA cycle) (1)
- Cysteine and methionine metabolism (1)
- DNA replication (1)
- Folate biosynthesis (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- Glycerophospholipid metabolism (1)
- Heparan sulfate biosynthesis (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Inositol phosphate metabolism (1)
- Linoleic acid metabolism (1)
- Oxidative phosphorylation (1)
- PPAR signaling pathway (1)
- Pentose and glucuronate interconversions (1)
- Pentose phosphate pathway (1)
- Primary immunodeficiency (1)
- Propanoate metabolism (1)
- Renin-angiotensin system (1)
- SNARE interactions in vesicular transport (1)
- Selenoamino acid metabolism (1)
- Sphingolipid metabolism (1)
- Systemic lupus erythematosus (1)