Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal Anti-HNRPUL1 Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the C terminal of human HNRPUL1. Synthetic peptide located within the following region: TYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal LSD1 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSD1 antibody: human LSD1 (Lysine-specific demethylase 1), using a KLH-conjugated synthetic peptide from the inner part of the protein. |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 17 amino acid peptide near the amino terminus of human PPARGC1A. The immunogen is located within amino acids 200 - 250 of PPARGC1A. |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
XRCC2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human XRCC2 |
Rabbit Polyclonal Anti-CENPN Antibody - middle region
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CENPN antibody: synthetic peptide directed towards the middle region of human CENPN. Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS |
Rabbit Polyclonal Anti-DAF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DAF antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DAF. The immunogen is located within amino acids 360 - 410 of DAF. |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Active filters
Category
- Antibodies
Applications
- IF
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Druggable Genome
Filter by
Target Symbol
- AKT1 (8)
- APP (6)
- BAX (6)
- KDM1A (6)
- CANX (5)
- GJA1 (5)
- IRF3 (5)
- IRS1 (5)
- PDIA3 (5)
- ACE2 (4)
- ANP32A (4)
- ATG5 (4)
- BCL2L11 (4)
- BIRC5 (4)
- CASP9 (4)
- ESR1 (4)
- HDAC2 (4)
- LIMK2 (4)
- RPS6KA1 (4)
- STAT3 (4)
- SUMO1 (4)
- TAC1 (4)
- TFAM (4)
- TP53 (4)
- TRIM5 (4)
- TUBA1A (4)
- XRCC6 (4)
- ACHE (3)
- ADD1 (3)
- ATP7B (3)
- BCL2 (3)
- CAMK1D (3)
- CASP6 (3)
- CAV2 (3)
- CFLAR (3)
- CHUK (3)
- CIDEB (3)
- CX3CR1 (3)
- CXCR4 (3)
- DFFB (3)
- EDNRA (3)
- ENO1 (3)
- FANCC (3)
- FASN (3)
- FEN1 (3)
- FH (3)
- FOXO1 (3)
- GSTP1 (3)
- H2AFX (3)
- HDAC1 (3)
- HNRNPD (3)
- HSPD1 (3)
- HTRA2 (3)
- IKBKB (3)
- IKBKG (3)
- IL16 (3)
- IRAK2 (3)
- KPNA2 (3)
- LIG3 (3)
- MAP3K5 (3)
- MCL1 (3)
- MET (3)
- MSH2 (3)
- MYC (3)
- NFKBIA (3)
- NPM1 (3)
- NQO1 (3)
- NR3C1 (3)
- P4HB (3)
- PIK3CD (3)
- PPARGC1A (3)
- PRKACA (3)
- PTGDR2 (3)
- RAB5A (3)
- RACGAP1 (3)
- RELA (3)
- RIPK2 (3)
- SHC1 (3)
- SIRT2 (3)
- SMAD2 (3)
- SNCA (3)
- TAAR5 (3)
- TNFAIP3 (3)
- TNFRSF25 (3)
- TRIM21 (3)
- TUBA4A (3)
- UCHL1 (3)
- ULK2 (3)
- UNG (3)
- VCL (3)
- ACKR1 (2)
- ACKR2 (2)
- ACKR4 (2)
- ADGRA2 (2)
- ADGRF5 (2)
- ADORA2B (2)
- ADORA3 (2)
- ADRA2A (2)
- ADRB2 (2)
- AIFM1 (2)
Reactivities
- Human (2004)
- Mouse (1308)
- Rat (934)
- Bovine (173)
- Pig (77)
- Monkey (68)
- Chicken (59)
- Rhesus Monkey (57)
- Canine (42)
- Xenopus (42)
- Dog (36)
- X. tropicalis (30)
- Zebrafish (30)
- Chimpanzee (23)
- Rabbit (19)
- Hamster (12)
- Cow (11)
- Sheep (10)
- Feline (8)
- Primate (6)
- Porcine (5)
- Drosophila (4)
- Guinea Pig (3)
- Goat (2)
- C. elegans (1)
- Horse (1)
- Mammalian (1)
- Medaka fish (1)
- Quail (1)
Antibody Hosts
Clonalities
Modifications
Assay Types
Pathways
- Pathways in cancer (232)
- Metabolic pathways (133)
- Neuroactive ligand-receptor interaction (108)
- MAPK signaling pathway (106)
- Neurotrophin signaling pathway (103)
- Cytokine-cytokine receptor interaction (100)
- Apoptosis (99)
- Focal adhesion (98)
- Colorectal cancer (90)
- Prostate cancer (90)
- Chemokine signaling pathway (83)
- Toll-like receptor signaling pathway (83)
- Small cell lung cancer (82)
- Chronic myeloid leukemia (80)
- Insulin signaling pathway (79)
- Cell cycle (74)
- Pancreatic cancer (71)
- Regulation of actin cytoskeleton (70)
- T cell receptor signaling pathway (65)
- Calcium signaling pathway (63)
- Adipocytokine signaling pathway (61)
- ErbB signaling pathway (61)
- p53 signaling pathway (57)
- Jak-STAT signaling pathway (56)
- Acute myeloid leukemia (55)
- Progesterone-mediated oocyte maturation (55)
- Glioma (54)
- NOD-like receptor signaling pathway (54)
- Wnt signaling pathway (54)
- Endometrial cancer (53)
- Melanoma (53)
- Non-small cell lung cancer (53)
- Endocytosis (51)
- RIG-I-like receptor signaling pathway (50)
- B cell receptor signaling pathway (49)
- Huntington's disease (48)
- Natural killer cell mediated cytotoxicity (46)
- Renal cell carcinoma (46)
- Oocyte meiosis (45)
- Leukocyte transendothelial migration (44)
- Alzheimer's disease (43)
- Gap junction (43)
- Amyotrophic lateral sclerosis (ALS) (42)
- Epithelial cell signaling in Helicobacter pylori infection (42)
- Axon guidance (40)
- Bladder cancer (38)
- VEGF signaling pathway (38)
- Adherens junction (37)
- Ubiquitin mediated proteolysis (37)
- mTOR signaling pathway (37)
- Fc gamma R-mediated phagocytosis (35)
- Melanogenesis (33)
- Tight junction (33)
- Vascular smooth muscle contraction (33)
- TGF-beta signaling pathway (31)
- Fc epsilon RI signaling pathway (30)
- Cytosolic DNA-sensing pathway (29)
- Parkinson's disease (29)
- Olfactory transduction (28)
- Type II diabetes mellitus (27)
- Basal cell carcinoma (26)
- GnRH signaling pathway (26)
- Pathogenic Escherichia coli infection (26)
- ECM-receptor interaction (25)
- Viral myocarditis (25)
- Long-term potentiation (24)
- Notch signaling pathway (24)
- Hematopoietic cell lineage (23)
- Purine metabolism (21)
- Antigen processing and presentation (20)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (20)
- Base excision repair (19)
- Cell adhesion molecules (CAMs) (19)
- Glycolysis / Gluconeogenesis (19)
- Thyroid cancer (19)
- Metabolism of xenobiotics by cytochrome P450 (18)
- Complement and coagulation cascades (17)
- Dilated cardiomyopathy (17)
- Lysosome (17)
- Phosphatidylinositol signaling system (17)
- Regulation of autophagy (17)
- Primary immunodeficiency (16)
- Systemic lupus erythematosus (16)
- Hypertrophic cardiomyopathy (HCM) (15)
- Long-term depression (15)
- PPAR signaling pathway (15)
- Inositol phosphate metabolism (14)
- Prion diseases (14)
- Vibrio cholerae infection (14)
- Non-homologous end-joining (13)
- Drug metabolism - cytochrome P450 (11)
- Hedgehog signaling pathway (11)
- Homologous recombination (11)
- Nucleotide excision repair (11)
- Type I diabetes mellitus (11)
- DNA replication (10)
- Glycerolipid metabolism (10)
- Mismatch repair (10)
- Retinol metabolism (10)
- Arachidonic acid metabolism (9)
- Arginine and proline metabolism (8)
- Butanoate metabolism (8)
- Fatty acid metabolism (8)
- Glutathione metabolism (8)
- Pyrimidine metabolism (8)
- Pyruvate metabolism (8)
- Renin-angiotensin system (8)
- Tyrosine metabolism (8)
- Valine (8)
- Drug metabolism - other enzymes (6)
- Fructose and mannose metabolism (6)
- Glycerophospholipid metabolism (6)
- Histidine metabolism (6)
- Maturity onset diabetes of the young (6)
- RNA degradation (6)
- Taste transduction (6)
- Alanine (5)
- Allograft rejection (5)
- Cardiac muscle contraction (5)
- Citrate cycle (TCA cycle) (5)
- Cysteine and methionine metabolism (5)
- Dorso-ventral axis formation (5)
- Folate biosynthesis (5)
- Linoleic acid metabolism (5)
- Pentose phosphate pathway (5)
- Primary bile acid biosynthesis (5)
- Propanoate metabolism (5)
- Proteasome (5)
- aspartate and glutamate metabolism (5)
- beta-Alanine metabolism (5)
- leucine and isoleucine degradation (5)
- Androgen and estrogen metabolism (4)
- Autoimmune thyroid disease (4)
- C21-Steroid hormone metabolism (4)
- Graft-versus-host disease (4)
- Oxidative phosphorylation (4)
- Tryptophan metabolism (4)
- Aminoacyl-tRNA biosynthesis (3)
- Asthma (3)
- Fatty acid biosynthesis (3)
- Galactose metabolism (3)
- Glycosaminoglycan degradation (3)
- N-Glycan biosynthesis (3)
- Taurine and hypotaurine metabolism (3)
- leucine and isoleucine biosynthesis (3)
- ABC transporters (2)
- Amino sugar and nucleotide sugar metabolism (2)
- Circadian rhythm - mammal (2)
- Glycine (2)
- Heparan sulfate biosynthesis (2)
- Lysine degradation (2)
- Methane metabolism (2)
- Nitrogen metabolism (2)
- Phenylalanine metabolism (2)
- Ribosome (2)
- SNARE interactions in vesicular transport (2)
- Selenoamino acid metabolism (2)
- Sphingolipid metabolism (2)
- Spliceosome (2)
- Synthesis and degradation of ketone bodies (2)
- Terpenoid backbone biosynthesis (2)
- serine and threonine metabolism (2)
- Ascorbate and aldarate metabolism (1)
- Basal transcription factors (1)
- Biosynthesis of unsaturated fatty acids (1)
- Caffeine metabolism (1)
- Chondroitin sulfate biosynthesis (1)
- Limonene and pinene degradation (1)
- Nicotinate and nicotinamide metabolism (1)
- O-Glycan biosynthesis (1)
- Other glycan degradation (1)
- Pantothenate and CoA biosynthesis (1)
- Pentose and glucuronate interconversions (1)
- Riboflavin metabolism (1)
- Starch and sucrose metabolism (1)
- Sulfur metabolism (1)